Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A2K5XJR2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mandrillus leucophaeus GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|A0A2K5XJR2_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mandrillus leucophaeus GN=BAD (length=156 residues).
MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGHSDADAAKL
QLDASLPVLVGSELGQGKLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQASCKRGSVLPLSVGGLTQIPFRCM
>gnl|bcl2dbpro|A0A2K5XSA1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mandrillus leucophaeus GN=BIK (length=156 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFLDGFTTLRENIMRFWRSPNPRSWVSREQVLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5Z4A9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mandrillus leucophaeus GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K5Z4A9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mandrillus leucophaeus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5Z7V3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5Z7V3_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=111 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2K5ZWH1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5ZWH1_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFTRGKKLVSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCILHKFEERLHCNW
© 1998-2020Legal notice