Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5ZWH1_PMAIP1-      -----------------------------MPGKKARKNAQPSPTRAQAEL
A0A2K5XSA1_BIK-01       MSGVRPISRDTLMETLLYEQLLEPLTME----------------VLGVTD
A0A2K5XJR2_BAD-01       MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5XJR2_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5XJR2_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5Z4A9_BMF-02       ------------------MEPSRCVEELEDD--VFQPEDGEPGAQPGSSL
A0A2K5Z4A9_BMF-01       ------------------MEPSRCVEELEDD--VFQPEDGEPGAQPGSSL
A0A2K5ZWH1_PMAIP1-      -----------------------------MPGKKARKNAQPSPTRAQAGQ
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
A0A2K5Z7V3_BCL2L11      ----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPT
                                                                          

A0A2K5ZWH1_PMAIP1-      EVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT-----------------
A0A2K5XSA1_BIK-01       PEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVA
A0A2K5XJR2_BAD-01       QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
A0A2K5XJR2_BAD-02       QQEQPTSSSHHGGT--------------SSPEERGHSDADAAKLQLDASL
A0A2K5XJR2_BAD-03       QQEQPTSSSHHGGGAWY-----------SPSWESEDSENPSARMLAEASA
A0A2K5Z4A9_BMF-02       SADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
A0A2K5Z4A9_BMF-01       SADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
A0A2K5ZWH1_PMAIP1-      AGTAGTARDQAGFGIGMQ----LHFTRGKKLVSSSPLALPRGHEEQVQV-
A0A2K5Z7V3_BCL2L11      SLQTEPQ-------------------------------------------
A0A2K5Z7V3_BCL2L11      SLQTEPQ-------------------------------------------
A0A2K5Z7V3_BCL2L11      SLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2K5Z7V3_BCL2L11      SLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2K5Z7V3_BCL2L11      SLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2K5Z7V3_BCL2L11      SLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2K5Z7V3_BCL2L11      SLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2K5Z7V3_BCL2L11      SLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2K5Z7V3_BCL2L11      SLQTEPQ-------------------------------------------
A0A2K5Z7V3_BCL2L11      SLQTEPQ-------------------------------------------
                                                                          

A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5XSA1_BIK-01       MHSLGLAFIYDQTD---DIRDVLRSFLDGFTTL-----RENIMRFWRSPN
A0A2K5XJR2_BAD-01       PPNLWAAQRYGR-----ELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSS
A0A2K5XJR2_BAD-02       PVLVGSELGQG------KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCF
A0A2K5XJR2_BAD-03       RMSAPATDSEAQLAENVKLKALGL-WRPGVATAPTPRGRRRTKGWRRSPA
A0A2K5Z4A9_BMF-02       GVMLPCGV---------TEEPQRLFYAPAEPKSRVVADPPL-----PAQP
A0A2K5Z4A9_BMF-01       GVMLPCGV---------TEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPP
A0A2K5ZWH1_PMAIP1-      ------------------------------ARSRVCYSTQEIWRQ-TELP
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      ------------------------------DRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      IFMRRSSL---------LSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      IFMRRSSL---------LSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      IFMRRSSL---------LSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      IFMRRSSL---------LSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      IFMRRSSL---------LSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      IFMRRSSL---------LSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      ------------------------------DRSPAPMSCDKSTQT-PSPP
A0A2K5Z7V3_BCL2L11      ------------------------------DRSPAPMSCDKSTQT-PSPP
                                                                          

A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5XSA1_BIK-01       PRSWVSREQVLLL-LALLLALLSGGLHLLLK-------------------
A0A2K5XJR2_BAD-01       WTRVFQSWWDRNLGRGSSAPSQ----------------------------
A0A2K5XJR2_BAD-02       PQASCK--------RGSVLPLSVGGLTQIPFRCM----------------
A0A2K5XJR2_BAD-03       PFGAARAPRPPTSGQHSVMAASSGG-------------------------
A0A2K5Z4A9_BMF-02       CFEWRREQERGGP-------------------------------------
A0A2K5Z4A9_BMF-01       EGQWQHRAEVQIARKLQCIADQFHRLHVQQHQ--------QNRNRVWWQI
A0A2K5ZWH1_PMAIP1-      AETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCILHKFEERLHCNW--
A0A2K5Z7V3_BCL2L11      -----------ASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYAR
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYAR
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMGIFE-----------------------------------
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMANWD-----------------------------------
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMVREIEEVVV------------------------------
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYAR
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYAR
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYAR
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAMVVILEDIGDSSLFGFIFTGLDLYG-----HHHSQDTEQL
A0A2K5Z7V3_BCL2L11      CQAFNHYLSAM-----DEATGSSLGIAL--------------HREVQWPL
                                                                          

A0A2K5ZWH1_PMAIP1-      ---------------------------------
A0A2K5XSA1_BIK-01       ---------------------------------
A0A2K5XJR2_BAD-01       ---------------------------------
A0A2K5XJR2_BAD-02       ---------------------------------
A0A2K5XJR2_BAD-03       ---------------------------------
A0A2K5Z4A9_BMF-02       ---------------------------------
A0A2K5Z4A9_BMF-01       LLFLHNLALNGEENRNGAGPR------------
A0A2K5ZWH1_PMAIP1-      ---------------------------------
A0A2K5Z7V3_BCL2L11      RLAELLASST-----------------------
A0A2K5Z7V3_BCL2L11      RVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5Z7V3_BCL2L11      ---------------------------------
A0A2K5Z7V3_BCL2L11      ---------------------------------
A0A2K5Z7V3_BCL2L11      ---------------------------------
A0A2K5Z7V3_BCL2L11      RVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5Z7V3_BCL2L11      RMSLPPD--------------------------
A0A2K5Z7V3_BCL2L11      RLEK-----------------------------
A0A2K5Z7V3_BCL2L11      NHKDFS---------------------------
A0A2K5Z7V3_BCL2L11      ECLASS---------------------------
                                                         

© 1998-2023Legal notice