Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5ZWH1_PMAIP1-      MPGKKARKNAQPSPTRAQAELE----------------------------
A0A2K5Z7V3_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDR
A0A2K5XSA1_BIK-01       -------------------MSGVRPISRDTLMETLLYEQLLEPLTME---
A0A2K5XJR2_BAD-01       -------------------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRP
A0A2K5XJR2_BAD-02       -------------------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRP
A0A2K5ZWH1_PMAIP1-      MPGKKARKNAQPSPTRAQAGQA-----GTAGTARDQAGFGIGMQLHFTRG
A0A2K5Z7V3_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K5Z4A9_BMF-02       ---------MEPSRCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSL
A0A2K5Z4A9_BMF-01       ---------MEPSRCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSL
                                                                          

A0A2K5ZWH1_PMAIP1-      -----------------------------VECATQLRRFGDKLNFRQKLL
A0A2K5Z7V3_BCL2L11      SP---------------------APMSCDKSTQTPSPPCQAFNHYLSAMV
A0A2K5XSA1_BIK-01       ----------------------VLGVTDPEEDLDPMEDFDPLECMEDSDM
A0A2K5XJR2_BAD-01       SD---------CGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSR
A0A2K5XJR2_BAD-02       SD---------CGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGH
A0A2K5ZWH1_PMAIP1-      KK--------------------LVSSSPLALPRGHEEQVQ----------
A0A2K5Z7V3_BCL2L11      PEGNHGGEGDSCPHGSPQ--------GPLAPPASPGPFATR-----SPLF
A0A2K5Z4A9_BMF-02       LD---------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
A0A2K5Z4A9_BMF-01       LD---------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
                                                                          

A0A2K5ZWH1_PMAIP1-      NLIAKLFCSGT---------------------------------------
A0A2K5Z7V3_BCL2L11      VILEDIGDSSLFGFIFTGLDLYGHHHSQDTEQLNHKDFS-----------
A0A2K5XSA1_BIK-01       LALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRS
A0A2K5XJR2_BAD-01       HSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGR--ELRRMSDE
A0A2K5XJR2_BAD-02       SDADAAKLQLDASL---------------PVLVGSELGQG--KLRPLPVT
A0A2K5ZWH1_PMAIP1-      --VARSRVCYSTQEIWRQTELPAETSESDSQTLLLR--------------
A0A2K5Z7V3_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLS
A0A2K5Z4A9_BMF-02       GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL-----PAQPCFEWRR---
A0A2K5Z4A9_BMF-01       GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQH---
                                                                          

A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5XSA1_BIK-01       FLDGFTTLRENIMRFWRSPNPRSWVSREQVL-------LLLALLLALLSG
A0A2K5XJR2_BAD-01       FVDSFKGL----------PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
A0A2K5XJR2_BAD-02       FA----------------PRPETPPALTVLVGHLGYGR--KCFPQASCKR
A0A2K5ZWH1_PMAIP1-      -----------------NLTASKTCIRGLQKRLFLRRCILHKFEERLHCN
A0A2K5Z7V3_BCL2L11      AMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHP
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A2K5Z4A9_BMF-01       -------------RAEVQIARKLQCIADQFHRLHVQQ--------HQQNR
                                                                          

A0A2K5ZWH1_PMAIP1-      ----------------------------
A0A2K5Z7V3_BCL2L11      ----------------------------
A0A2K5XSA1_BIK-01       GLHLLLK---------------------
A0A2K5XJR2_BAD-01       GSSAPSQ---------------------
A0A2K5XJR2_BAD-02       GSVLPLSVGGLTQIPFRCM---------
A0A2K5ZWH1_PMAIP1-      W---------------------------
A0A2K5Z7V3_BCL2L11      QMVILRLLRYIVRLVWRMH---------
A0A2K5Z4A9_BMF-02       ------------------EQERGGP---
A0A2K5Z4A9_BMF-01       NRVWWQILLFLHNLALNGEENRNGAGPR
                                                    

© 1998-2020Legal notice