Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaarargaacgalgcpaecggglagrrglcaapgtlnpspelcflrclrgdgqgapgrrrararrpgararar
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------ps---selere--vlqpeerepqlqpgsslslqlfpqslle---------cp----ql-pl-
tlrsegkartkkdqmamq--rvve-cdddgrqfgvadgprgar--apt-adteap---dgnhggegds--lsrl--f--t
                ke  dcs-p----ktms irptsqst-me---ye--l--gnp-drpsds khhrhgsplgw  a
                       m skn   n   q in dmledtlsa-rg-g ltmg           qapg vl   
                                   p f   e           e  pa                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----pg---t--------------------------drstqtmspdsssqtvslpc---qepqrllyanagyrqplpasm
hccg--lrp-sqelfifmrrssllsrsssgyfsfdt-kapaplgcakpt-gpmp--gvteafnhyfsgm-sr-lae--df
ppas  pfa rsp                       g-----e------h----gaved----------t--e---sl--
                                     vthpq-qltpmedhnpae m  ssrlssyp gieedmgveerp
                                     a d e d      fgg      rdmha rl c  d edm  ea

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     .   :      : . :                                           
-----------------rpeiq---iarklrrigdqfnrlyvrr--------hq---------------------qnrnr
pavlpigeqppegqwqhqayvrmdelrqesqcfagelhayhaqqvflnnyqaaesagtatqmrqssswtrvfqswdhpqm
srlrqrsrvampslglafrqg   df kvkds v s ttr----mrswrsprprp                    -----
 pfagl  s  hn  a el d      dr  e m r kg rkslalfp lensk                     ws eq
                  i         m  a   g    deni       c g                     vd   

       330       340       350        
....:....|....:....|....:....|....:...
                                      
vwlrlllylvrlvwrmh---------------------
-iwqi-rfihn-alngeqnrngagprpltwngavvkpc
 ---- ----- ---l-rgsslpsq             
 l v   l al lal-sg lhallk             
                g                     
© 1998-2022Legal notice