Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A1D5QBW1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca mulatta GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|A0A5F7ZML1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=196 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPRPLTWNGAVVKPC
>gnl|bcl2dbpro|A0A5F7ZML1_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
>gnl|bcl2dbpro|A0A5F7ZML1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
>gnl|bcl2dbpro|A0A5F8ATY0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca mulatta GN=PMAIP1 (length=54 residues).
MPSKNEKTNLQPQPTNQQMELQIQFAKRKRAFGGRLNRRDKSLALSPRLECSGP
>gnl|bcl2dbpro|F6SUD3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca mulatta GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|F7HHA1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=232 residues).
MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAR
TLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|F7HHA1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=292 residues).
MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAR
TLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEI
RIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|F7HHA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
© 1998-2022Legal notice