Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|F7CM09_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=196 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPRPLTWNGAVVKPC
>gnl|bcl2dbpro|F7CM09_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
>gnl|bcl2dbpro|F7CM09_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
© 1998-2020Legal notice