Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A5F7ZML1_BMF-01       --------------------------------------------------
A0A5F7ZML1_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-02       --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-03       MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
F7HHA1_BCL2L11-02       MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
                                                                          

A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A5F7ZML1_BMF-01       ----------------------------------------------MEPS
A0A5F7ZML1_BMF-03       ----------------------------------------------MEPS
A0A5F7ZML1_BMF-02       ----------------------------------------------MEPS
F7HHA1_BCL2L11-01       --------------------------------------------MAKQPS
F7HHA1_BCL2L11-03       FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
F7HHA1_BCL2L11-02       FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
                                                                          

A0A5F8ATY0_PMAIP1-      ---MPSKNEKTNLQPQPTNQQM----------------------------
A0A1D5QBW1_BAD-01       -----------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHR
F6SUD3_BIK-01           -----------MSGVRPISRDTLMETLLYEQLLEPLTME-----------
A0A5F7ZML1_BMF-01       RCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD---------CP
A0A5F7ZML1_BMF-03       RCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD---------CP
A0A5F7ZML1_BMF-02       RCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD---------CP
F7HHA1_BCL2L11-01       DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
F7HHA1_BCL2L11-03       DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
F7HHA1_BCL2L11-02       DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
                                                                          

A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A1D5QBW1_BAD-01       QAPGLLW---------------------------------------DASH
F6SUD3_BIK-01           -----VL---------------------------------------GVTD
A0A5F7ZML1_BMF-01       LSRLQLFPLTHCCGPGLRPTSQE-----------------------DKAT
A0A5F7ZML1_BMF-03       LSRLQLFPLTHCCGPGLRPTSQE-----------------------DKAT
A0A5F7ZML1_BMF-02       LSRLQLFPLTHCCGPGLRPTSQE-----------------------DKAT
F7HHA1_BCL2L11-01       HGSPQG-PLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSP
F7HHA1_BCL2L11-03       ----------------------------------------------DRSP
F7HHA1_BCL2L11-02       HGSPQG-PLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSP
                                                                          

A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A1D5QBW1_BAD-01       QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
F6SUD3_BIK-01           PEEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVA
A0A5F7ZML1_BMF-01       QTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
A0A5F7ZML1_BMF-03       QTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
A0A5F7ZML1_BMF-02       QTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
F7HHA1_BCL2L11-01       APMSCDKSTQTPSPPC---QAFNHYLSAMASRRQAEPADM----------
F7HHA1_BCL2L11-03       APMSCDKSTQTPSPPC---QAFNHYLSAMASRRQAEPADM----------
F7HHA1_BCL2L11-02       APMSCDKSTQTPSPPC---QAFNHYLSAMASRRQAEPADM----------
                                                                          

A0A5F8ATY0_PMAIP1-      -------ELQIQ---FAKRKRAFGGRLNRRDKSLALSPRLECSGP-----
A0A1D5QBW1_BAD-01       PPNLWAAQRYGR--ELRRMSDEFVDSFKGL----------PRPKSAGTAT
F6SUD3_BIK-01           MHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPR------
A0A5F7ZML1_BMF-01       PEGQWQHRAEVQ---IARKLQCIADQFHRLHVQQ--------HQ------
A0A5F7ZML1_BMF-03       PEGQWQHRAEVQ---IARKLQCIADQFHRLHVQQ--------HQ------
A0A5F7ZML1_BMF-02       PEGQWQHRAEVQ---IARKLQCIADQFHRLHVQQ--------HQ------
F7HHA1_BCL2L11-01       -------RPEIR---IAQELRRIGDEFNAYYARRVFLNNYQAAE------
F7HHA1_BCL2L11-03       -------RPEIR---IAQELRRIGDEFNAYYARRVFLNNYQAAE------
F7HHA1_BCL2L11-02       -------RPEIR---IAQELRRIGDEFNAYYARRVFLNNYQAAE------
                                   .   :      : . :                       

A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A1D5QBW1_BAD-01       QMRQSSSWTRVFQSWWDRN----------------LGRGSSAPSQ-----
F6SUD3_BIK-01           -------------SWVSREQVLLVLLLLLALLLALLSGGLHLLLK-----
A0A5F7ZML1_BMF-01       ---------------QNRNRVWWQILLFLHNLALNGEQNRNGAGPRPLTW
A0A5F7ZML1_BMF-03       ---------------QNRNRVWWQILLFLHNLALNGEQNRNGAGPR----
A0A5F7ZML1_BMF-02       ---------------QNRNRVWWQILLFLHNLALNGEQNRNGAGPR----
F7HHA1_BCL2L11-01       ---------------DHPQMVILRLLRYIVRLVWRMH-------------
F7HHA1_BCL2L11-03       ---------------DHPQMVILRLLRYIVRLVWRMH-------------
F7HHA1_BCL2L11-02       ---------------DHPQMVILRLLRYIVRLVWRMH-------------
                                                                          

A0A5F8ATY0_PMAIP1-      --------
A0A1D5QBW1_BAD-01       --------
F6SUD3_BIK-01           --------
A0A5F7ZML1_BMF-01       NGAVVKPC
A0A5F7ZML1_BMF-03       --------
A0A5F7ZML1_BMF-02       --------
F7HHA1_BCL2L11-01       --------
F7HHA1_BCL2L11-03       --------
F7HHA1_BCL2L11-02       --------
                                

© 1998-2022Legal notice