Dataset for protein Bim of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mfpaaaagaarargaacgalgcpaecggglagrrglcaapgtlnpspelcflrclrgdgqgapgrrrararrpgararar
--------------------------------------------------------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *****************************************                         
tlrsegkartkkdqMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplap
--------------                                         -------------------------

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   *********************************************
paspgpfatrsplfifmrrssllsrsssgyfsfdtDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEI
-----------------------------------                                             

       250       260       270       280       290  
....:....|....:....|....:....|....:....|....:....|..
****************************************************
RIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
                                                    
© 1998-2020Legal notice