Dataset for protein Bim of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HHA1_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-03      MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
F7HHA1_BCL2L11-02      MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
                                                                         

F7HHA1_BCL2L11-01      --------------------------------------------MAKQPS
F7HHA1_BCL2L11-03      FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
F7HHA1_BCL2L11-02      FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
                                                                   ******

F7HHA1_BCL2L11-01      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
F7HHA1_BCL2L11-03      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
F7HHA1_BCL2L11-02      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
                       ***********************************               

F7HHA1_BCL2L11-01      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
F7HHA1_BCL2L11-03      ---------------------------------------------DRSPA
F7HHA1_BCL2L11-02      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
                                                                    *****

F7HHA1_BCL2L11-01      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
F7HHA1_BCL2L11-03      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
F7HHA1_BCL2L11-02      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
                       **************************************************

F7HHA1_BCL2L11-01      DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
F7HHA1_BCL2L11-03      DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
F7HHA1_BCL2L11-02      DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
                       ******************************************

© 1998-2020Legal notice