Dataset for protein Bim of organism Macaca mulatta

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|F7HHA1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=232 residues).
MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAR
TLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|F7HHA1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=292 residues).
MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAR
TLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEI
RIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|F7HHA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
© 1998-2020Legal notice