Dataset for protein classical BH3-containing proteins of organism Lynx canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssecdreggqlqpaerp-------------------pqlrpg---aptslqteqqgnprg--d-cp
mfqipe-----qe---p-e--vfls-dg---rgpgkhqrtapgllgefpl------sllsvnv-g--g----e-eg-r--
      fersr--hvg-l-pv----t--qeh                aghsrtq s   -selh-vs-rvdl-syyssys
        peepsgae tsdnl pprtlp                     qggv a   geshfdqprmtstverrqlle
        ma mqd      ge  apf d                               a caagg lseml hlg f 
             c      d    e                                       aa adc   aha   
                                                                     a          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-g-pqgplappaspgpfatrs-------------------------f--drspapmscdkstqtpsppcqafnhylsamp
q-s------------------rtapplfifvrrssllsrsssgyfs-dt-e--qr---g-age-lgs---s-arf-ag-a
stvepdegtrvtpvsdyrcst s   nvwaalgyprwpprqrvrprgsvt-me--wmy-w---r--llvy-w---y--t-
pltcla apnsrlqpavlmqp     alt    lgpelggpgsmlqcprpglar rfsstveynrq-arpgltstpqslg
l l e  sleene e r gal            g  a   m de p igkdg g lcmprg  m pm  h grgpinqg 
a h c     al  d k                            a gf  e   k l p   l e     apfa  e  
    a      e  a                                    a     a n   h                
                                                                                

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                               
smr-----qpqavpadmrpeiwiaqeLrrigdefnayyprrl-------------------------------------
l--trksa----------------rq----a--l--------flnqyqasgrqpqmiillllrylvrlvwrlqpgvgpr
-re     vlsvrrwqhqwavewm-- qnm-sq-sqwqkltvrrvnssyaearwwwsynrivlliplprhlnrneae n
tqg     a rsghepeea rqlgmn gclrenprirgf mrqqsvqrrrrtpvrvql  fthn gwnleega      
gka       ppag ea     cddk a g  kihfl e  nlnrplpqnpsglall     g  a gaa         
 g        ge            ag   f  d         hmqkhfni                             
 f                              a         eie a h                              
                                          ae                                   
© 1998-2020Legal notice