Dataset for protein classical BH3-containing proteins of organism Lynx canadensis

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A667G4D3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Lynx canadensis GN=BIK (length=148 residues).
MSHAGPLSRNVFLSTFLQEHGPEVLDVPGMTDLVEYYDPGPSPNSNSPDDVAMRLAFIGDEMEGRWMMPRVGELPGMAVY
SLAFTYNQTGLRGVLRSLMDGLANLRENIRIWGFLTLRNRVSPNSGRGLALSLLLLVLLLGWGLHLLQ
>gnl|bcl2dbpro|A0A667H8Z9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Lynx canadensis GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGHQQGQPASSNHHGGAGAVETRSRHSSYPAGT
EEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRFIQSWWDRNLG
RGGSAPSQ
>gnl|bcl2dbpro|A0A667H967_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Lynx canadensis GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A667H9R7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A667H9R7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L11 (length=131 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE
>gnl|bcl2dbpro|A0A667H9R7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A667H9R7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RVPASYI
>gnl|bcl2dbpro|A0A667H9R7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Lynx canadensis GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A667HYB7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Lynx canadensis GN=PMAIP1 (length=123 residues).
EESAGAGRRSDLRGARASLSSLVELGPAAPVRPVPPRACSSRAAAPRCSGWGTENPGLLRHGGRRPLAEMPGKRTRKSAQ
PSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
>gnl|bcl2dbpro|A0A667IM83_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Lynx canadensis GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLITGLLPLPRARGAPEVEPN
© 1998-2020Legal notice