Dataset for protein classical BH3-containing proteins of organism Lynx canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667HYB7_PMAIP1-      ------------------------------------------EESAGAGR
A0A667G4D3_BIK-01       --------------------------------------------------
A0A667H967_BMF-01       --------MEPPQCVE---------------------ELEDDVFQPEDGE
A0A667IM83_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A667H8Z9_BAD-01       MFQIPEFEPSEQEDSS-------------------PTDRGLGPSPTGDRP
A0A667H9R7_BCL2L11      ------MAKQPSDVSS-------------------ECDREGGQLQPAERP
A0A667H9R7_BCL2L11      ------MAKQPSDVSS-------------------ECDREGGQLQPAERP
A0A667H9R7_BCL2L11      ------MAKQPSDVSS-------------------ECDREGGQLQPAERP
A0A667H9R7_BCL2L11      ------MAKQPSDVSS-------------------ECDREGGQLQPAERP
A0A667H9R7_BCL2L11      ------MAKQPSDVSS-------------------ECDREGGQLQPAERP
                                                                          

A0A667HYB7_PMAIP1-      RSDLRGARASLSSLVELGPAAPVRPVPPRACSSRAAAPRCSGW-------
A0A667G4D3_BIK-01       --MSHAGPLSRNVFLSTFLQEHGPEVLDVPGMTDLVEYYDPGPSPNSNS-
A0A667H967_BMF-01       PGTQPGSLLSANLFAQ----SQLDCPLSHLQLFPLTHCCGPGLRPTSQED
A0A667IM83_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGP-------
A0A667H8Z9_BAD-01       RG--PG------KHQRTAPGLLGEAGHQQGQPASSNHHGGAGAVETRSRH
A0A667H9R7_BCL2L11      PQLRPGAPTSLQTEQQ----------------------------------
A0A667H9R7_BCL2L11      PQLRPGAPTSLQTEQQ----------------------------------
A0A667H9R7_BCL2L11      PQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPL
A0A667H9R7_BCL2L11      PQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPL
A0A667H9R7_BCL2L11      PQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPL
                             .                                            

A0A667HYB7_PMAIP1-      ----------GTENPGLLRHGGRRPLAEMPGKRTRKSAQPS---------
A0A667G4D3_BIK-01       ----------PDDVAMRLAFIGDEMEGRWMMPRVGELPGMAVYSLAFTYN
A0A667H967_BMF-01       KATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA-----SFPA
A0A667IM83_BBC3-01      ------------------------QPSLSPAEQHLESPVPSAPGA---LA
A0A667H8Z9_BAD-01       ----------------------SSYPAGTEEDEGTEEEEPS---------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      ----------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLS
A0A667H9R7_BCL2L11      FIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLS
A0A667H9R7_BCL2L11      FIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLS
A0A667H9R7_BCL2L11      FIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLS
                                                                          

A0A667HYB7_PMAIP1-      ---------PARAPAEPEVECAMQLRRFGDKLNFRQ--------------
A0A667G4D3_BIK-01       QTGLRGVLRS----------LMDGLANLRENIRIWGFLTLRNRVSPNSGR
A0A667H967_BMF-01       GLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLH-----------MQQ
A0A667IM83_BBC3-01      GGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALY----ERRRQEEQQR
A0A667H8Z9_BAD-01       --PFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQ
A0A667H9R7_BCL2L11      --ASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYY---PRRLARVPASY
A0A667H9R7_BCL2L11      AMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYY---PRRVFLNNYQA
A0A667H9R7_BCL2L11      AMGLFE--------------------------------------------
A0A667H9R7_BCL2L11      AMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYY---PRRLEQ-----
A0A667H9R7_BCL2L11      AMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYY---PRRVFLNNYQA
                                                                          

A0A667HYB7_PMAIP1-      ----------KLMNLISKLFRSGT---------
A0A667G4D3_BIK-01       GLALSLLLLVLLLGWGLHLLQ------------
A0A667H967_BMF-01       HQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
A0A667IM83_BBC3-01      HRPSPWRVLYNLITGLLPLPRARGAPEVEPN--
A0A667H8Z9_BAD-01       MRQSPSWTRFIQSWWDRNLGRGGSAPSQ-----
A0A667H9R7_BCL2L11      I--------------------------------
A0A667H9R7_BCL2L11      AEAQPQMIILRLLRYIVRLVWRLQ---------
A0A667H9R7_BCL2L11      ---------------------------------
A0A667H9R7_BCL2L11      ---------------------------------
A0A667H9R7_BCL2L11      AEAQPQMIILRLLRYIVRLVWRLQ---------
                                                         

© 1998-2021Legal notice