Dataset for protein classical BH3-containing proteins of organism Lynx canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667H9R7_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP-------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A667G4D3_BIK-01       -----------MSHAGPLSRNVFLSTFLQEH-------------------
A0A667H967_BMF-01       --------MEPPQCVEELEDDVFQPEDGE---------------------
A0A667IM83_BBC3-01      ------MARARQEGSSP-EPVEGLARDGPRP----------------FPL
A0A667H8Z9_BAD-01       MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGH
A0A667H9R7_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP-------------------
A0A667H9R7_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP-------------------
A0A667H9R7_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP-------------------
A0A667H9R7_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERP-------------------
                                                                          

A0A667H9R7_BCL2L11      PQLRPG---APTSLQTEQQASMR---------------------------
A0A667HYB7_PMAIP1-      ----------EESAGAGRRSDLRGARASLSSLVELGPAAPVRPVPPRACS
A0A667G4D3_BIK-01       ---------GPEVLDVPGMTDLVEYYD-------PGPSPNSNSPDDVAMR
A0A667H967_BMF-01       PGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQ
A0A667IM83_BBC3-01      SRLVPS---AVSC-------------GLCEPGLPAAPAAPALLPAAYLCA
A0A667H8Z9_BAD-01       QQGQPA---SSNHHGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGR
A0A667H9R7_BCL2L11      PQLRPG---APTSLQTEQQ-------------------------------
A0A667H9R7_BCL2L11      PQLRPG---APTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATR
A0A667H9R7_BCL2L11      PQLRPG---APTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATR
A0A667H9R7_BCL2L11      PQLRPG---APTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATR
                                                                          

A0A667H9R7_BCL2L11      --------------------------------------------------
A0A667HYB7_PMAIP1-      S-----------------------------RAAAPRCSGWGTENPGLLRH
A0A667G4D3_BIK-01       L------------------------AFIGDEMEGRWMMPRVGELPGMAVY
A0A667H967_BMF-01       T------------LSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP--
A0A667IM83_BBC3-01      P-TAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQP-SLSPAEQHLESPVP
A0A667H8Z9_BAD-01       SRSAPPNLWAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSP--
A0A667H9R7_BCL2L11      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
A0A667H9R7_BCL2L11      S----PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
A0A667H9R7_BCL2L11      S----PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
A0A667H9R7_BCL2L11      S----PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
                                                                          

A0A667H9R7_BCL2L11      ------------------QPQAVPADMRPEIWIAQELRRIGDEFNAYYPR
A0A667HYB7_PMAIP1-      GGRRPLAEMPGKRTRKSAQPSPARAPAEPEVECAMQLRRFGDKLNFRQKL
A0A667G4D3_BIK-01       SLAFTYNQTGLRG-----VLRS----------LMDGLANLRENIRIWGFL
A0A667H967_BMF-01       --ASFPAGLPLGE-----QPPEGHWQHRAEVQIARKLQCIADQFH-----
A0A667IM83_BBC3-01      SAPGALAGGPTQA-----APGVRGEEEQWAREIGAQLRRMADDLNALYER
A0A667H8Z9_BAD-01       SWTRFIQS-----------------------WWDRNLGRGGSAPSQ----
A0A667H9R7_BCL2L11      AFNHYLSAMASMR-----QPQAVPADMRPEIWIAQELRRIGDEFNAYYPR
A0A667H9R7_BCL2L11      AFNHYLSAMGLFE-------------------------------------
A0A667H9R7_BCL2L11      AFNHYLSAMASMR-----QPQAVPADMRPEIWIAQELRRIGDEFNAYYPR
A0A667H9R7_BCL2L11      AFNHYLSAMASMR-----QPQAVPADMRPEIWIAQELRRIGDEFNAYYPR
                                                                          

A0A667H9R7_BCL2L11      RLARVPASYI-----------------------------
A0A667HYB7_PMAIP1-      MNLISKLFRSGT---------------------------
A0A667G4D3_BIK-01       TLRNRVSPNSGRGLALSLLLLVLLLGWGLHLLQ------
A0A667H967_BMF-01       RLHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
A0A667IM83_BBC3-01      RRQEEQQRHRPSPWRVLYNLITGLLPLPRARGAPEVEPN
A0A667H8Z9_BAD-01       ---------------------------------------
A0A667H9R7_BCL2L11      RVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ------
A0A667H9R7_BCL2L11      ---------------------------------------
A0A667H9R7_BCL2L11      RLEQ-----------------------------------
A0A667H9R7_BCL2L11      RVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ------
                                                               

© 1998-2020Legal notice