Dataset for protein Bim of organism Lates calcarifer

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         *:**:: :  .: :    .:* : *  .:  **.     
-------------------------------------rppnQsDGstevtareesggdphvDgaaGasaqtsRSndggg-
myiyicictykyitdsltscysrsqrlcratdmqpps-mka a  aa-lfiqqttkpvrwl rsn krgerr  trrrcr
                                    q                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *.: .* .*     .**   *** . .  :   .   ****************************************
---GgersFghRgstgggELadsPPRcrtkais---pldsLGVFQKRSIFSYPRRSSSGYFSFDGESLPSSPLSPRPATA
wsl anvp er rrrrra  --w   lhrrrragglaapv                                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************** .      *************************************
DRATQTPSPTSQVMKHFLQRMTEAHGRGPGTQQLHgs------SPNPSSTQQRNAAGDMQTEAVIGQELRRIGDDFNRLL
                                   vdtpvlll                                     
                                                                                

       250       260       270       280       290       
....:....|....:....|....:....|....:....|....:....|....:..
***               :.* .:   * :** : : * **     **         
LLRgvagghrpvvipqqqlpHihqeptVllCVgilllViGRiiylqGGmnnqdhaqv
   ---------------vs hrhcvc cv  cvcvc c  -----  ---------
                                                         
© 1998-2020Legal notice