Dataset for protein Bim of organism Lates calcarifer

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                         *:**:: :  .: :    .:* : *  .:  **.     
myiyicictykyitdsltscysrsqrlcratdmqpps-mka a  aa-lfiqqttkpvrwl rsn krgerr  trrrcr

        90       100       110       120       130       140       150       160
   *.: .* .*     .**   *** . .  :   .   ****************************************
wsl anvp er rrrrra  --w   lhrrrragglaapv                                        

       170       180       190       200       210       220       230       240
*********************************** .      *************************************

       250       260       270       280       290       
***               :.* .:   * :** : : * **     **         
   ---------------vs hrhcvc cv  cvcvc c  -----  ---------
© 1998-2023Legal notice