Dataset for protein Bim of organism Lates calcarifer

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W6ETK4_BCL2L11      --------------------------------------MKAQADGAA-LF
A0A4W6ETK4_BCL2L11      ------------------------------------QRPPNQSDGSTEVT
A0A4W6ETK4_BCL2L11      MYIYICICTYKYITDSLTSCYSRSQRLCRATDMQPPSRPPNQSDGSTEVT
                                                                 *:**:: : 

A0A4W6ETK4_BCL2L11      IQQTTKPVRWLDRSNGKRGERRRSTRRRCRWSLGANVPFERRRRRRRAEL
A0A4W6ETK4_BCL2L11      AREESGGDPHVDGAAGASAQTSRSNDGGG----GGERSFGHRGSTGGGEL
A0A4W6ETK4_BCL2L11      AREESGGDPHVDGAAGASAQTSRSNDGGG----GGERSFGHRGSTGGGEL
                         .: :    .:* : *  .:  **.        *.: .* .*     .**

A0A4W6ETK4_BCL2L11      --WPPRLHRRRRAGGLAAPVLGVFQKRSIFSYPRRSSSGYFSFDGESLPS
A0A4W6ETK4_BCL2L11      ADSPPRCRTKAIS---PLDSLGVFQKRSIFSYPRRSSSGYFSFDGESLPS
A0A4W6ETK4_BCL2L11      ADSPPRCRTKAIS---PLDSLGVFQKRSIFSYPRRSSSGYFSFDGESLPS
                           *** . .  :   .   ******************************

A0A4W6ETK4_BCL2L11      SPLSPRPATADRATQTPSPTSQVMKHFLQRMTEAHGRGPGTQQLHVDTPV
A0A4W6ETK4_BCL2L11      SPLSPRPATADRATQTPSPTSQVMKHFLQRMTEAHGRGPGTQQLHGS---
A0A4W6ETK4_BCL2L11      SPLSPRPATADRATQTPSPTSQVMKHFLQRMTEAHGRGPGTQQLHGS---
                        ********************************************* .   

A0A4W6ETK4_BCL2L11      LLLSPNPSSTQQRNAAGDMQTEAVIGQELRRIGDDFNRLLLLR-------
A0A4W6ETK4_BCL2L11      ---SPNPSSTQQRNAAGDMQTEAVIGQELRRIGDDFNRLLLLRGVAGGHR
A0A4W6ETK4_BCL2L11      ---SPNPSSTQQRNAAGDMQTEAVIGQELRRIGDDFNRLLLLRGVAGGHR
                           ****************************************       

A0A4W6ETK4_BCL2L11      --------VSHHRHCVCVCVCVCVCVCVCGR-----GG---------
A0A4W6ETK4_BCL2L11      PVVIPQQQLPHIHQEPTVLLCVGILLLVIGRIIYLQGGMNNQDHAQV
A0A4W6ETK4_BCL2L11      PVVIPQQQLPHIHQEPTVLLCVGILLLVIGRIIYLQGGMNNQDHAQV
                                :.* .:   * :** : : * **     **         

© 1998-2020Legal notice