Dataset for protein Bim of organism Lates calcarifer

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A4W6ETK4_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L11 (length=227 residues).
MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRRSTRRRCRWSLGANVPFERRRRRRRAELWPPRLHRRRRAGGLAAPVL
GVFQKRSIFSYPRRSSSGYFSFDGESLPSSPLSPRPATADRATQTPSPTSQVMKHFLQRMTEAHGRGPGTQQLHVDTPVL
LLSPNPSSTQQRNAAGDMQTEAVIGQELRRIGDDFNRLLLLRVSHHRHCVCVCVCVCVCVCVCGRGG
>gnl|bcl2dbpro|A0A4W6ETK4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L11 (length=248 residues).
QRPPNQSDGSTEVTAREESGGDPHVDGAAGASAQTSRSNDGGGGGERSFGHRGSTGGGELADSPPRCRTKAISPLDSLGV
FQKRSIFSYPRRSSSGYFSFDGESLPSSPLSPRPATADRATQTPSPTSQVMKHFLQRMTEAHGRGPGTQQLHGSSPNPSS
TQQRNAAGDMQTEAVIGQELRRIGDDFNRLLLLRGVAGGHRPVVIPQQQLPHIHQEPTVLLCVGILLLVIGRIIYLQGGM
NNQDHAQV
>gnl|bcl2dbpro|A0A4W6ETK4_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L11 (length=284 residues).
MYIYICICTYKYITDSLTSCYSRSQRLCRATDMQPPSRPPNQSDGSTEVTAREESGGDPHVDGAAGASAQTSRSNDGGGG
GERSFGHRGSTGGGELADSPPRCRTKAISPLDSLGVFQKRSIFSYPRRSSSGYFSFDGESLPSSPLSPRPATADRATQTP
SPTSQVMKHFLQRMTEAHGRGPGTQQLHGSSPNPSSTQQRNAAGDMQTEAVIGQELRRIGDDFNRLLLLRGVAGGHRPVV
IPQQQLPHIHQEPTVLLCVGILLLVIGRIIYLQGGMNNQDHAQV
© 1998-2020Legal notice