Dataset for protein classical BH3-containing proteins of organism Jaculus jaculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                              .                                              *  
mmp--mespqcve-ldddvrdlprpvpt-qfveadeecvgdldlmg----tqqgsllsadlfaqsqmrlplsryvqf lt
isgtrrkeg----p-----qagga filervp ta--        elveksn virslgsiagprvwdcrsqamlll tm
 ferppi  sspt vfllq          p g s vs         gc g l  a r  cdgdgmrpa lpp  fci gg
  age    n f  t gha                l          c    e           eadl  aaa    a ef
   a                                                                           a

        90       100       110       120       130       140       150       160
                                                                      * *.      
hpc-p-l-pt-qepk--qtls-aspsqgvmlpcgvtvrrssllsrsssgyfsfdteepqrpsygnagyrl l psqahyg
pcsvtavtygqtwdsatlstpvsprpfatrs lfif                   rqlls fpnlsywss v aass   
nthsqetssphrsvq vsrslrg g d                            hpdig lkdirhrer t  npe   
emeel elgf grgl  rprga                                 gga d  gaeqcl   q        
a a e d c  eg g   ap                                                            

       170       180       190       200       210       220       230       240
          hssf-t-l---e---q-p---  qscral-pi--rr i a- ----g-----lqg    pnlkahednpd
               a thiq-nmtdqlsvv  e     en-ll e    q llls d elsfk      hqesqgtatp
                  eeds  e aapgf          q        a      a  gq e       p e  r   

       250       260        
srqsvsytrimq wpl rgg a ea p 
 p rs wnl ig l d n          
© 1998-2023Legal notice