Dataset for protein classical BH3-containing proteins of organism Jaculus jaculus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C5K765_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Jaculus jaculus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDEEPGTQPGSLLSADLFAQSQMDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPTGLPLEEQPPEGQWPHRAEVQIARKLQCIADQFHRLHLQQHQQNRDRAW
WQVFLFLHNLALNREENRDGAGPR
>gnl|bcl2dbpro|A0A8C5K765_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Jaculus jaculus GN=BMF (length=189 residues).
IFPGEMEPPQCVEELEDDVFQPEDEEPGTQPGSLLSADLFAQSQMDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPTGLPLEEQPPEGQWPHRAEVQIARKLQCIADQFHRLHLQQHQQN
RDRAWWQVFLFLHNLALNREENRDGAGPR
>gnl|bcl2dbpro|A0A8C5KS51_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Jaculus jaculus GN=BIK (length=152 residues).
MSEARPISGNVFTETFLHQQALGAPVITEPVGEEDLPPVGDLDLMECLEGSNQVALRLACIGDEMDLRLRSPRLVQLPGM
AMHSLAVTYGQTGVSGVLRSLVHGLIDLSKNLRCWSLPTPSAWVHRGQVCRQLPPLLLALLLLGGALHLLLQ
>gnl|bcl2dbpro|A0A8C5KS76_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Jaculus jaculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAVPALLPAAYLCAPTAPTAVTATLGGSRWPGG
PRSRPRGPRPDGPDLSLSPAEQHLESPVPSAPEALEGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVVYNLFMGLLPLPRGPGAPEMEPN
>gnl|bcl2dbpro|A0A8C5L6N3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Jaculus jaculus GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFV
RRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPTDMRPEIWIAQELRRIGDEFNA
YYPRRVFLNNYQAAEDHPQMVILRLLRYFVRLVWRRH
>gnl|bcl2dbpro|A0A8C5L6N3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Jaculus jaculus GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQE
EPTDMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPQMVILRLLRYFVRLVWRRH
>gnl|bcl2dbpro|A0A8C5L6N3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Jaculus jaculus GN=BCL2L11 (length=81 residues).
MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMHIQSNPQD
Q
>gnl|bcl2dbpro|A0A8C5P449_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Jaculus jaculus GN=BAD (length=201 residues).
MGTPKKPSLPPTEPQGVRKSEPGIRSLGSDAGGRRWRLAAQSMFQIPEFEPSEQEESSFSERGLGPSPTGPRQAPGLLGD
ISYRQRPQPSNSSHYGGGGALETRSRHSSYPAGTEEDGGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFK
GLPRPKSAGTATQMRQSSSWTRIIQSWWDRNLGRGGPAPSQ
© 1998-2022Legal notice