Dataset for protein classical BH3-containing proteins of organism Jaculus jaculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5L6N3_BCL2L11      ---MAKQPSDVSSECDREG---------GQLQPAERPP-------QQLRP
A0A8C5KS51_BIK-01       MSEARPISGNVFTETFLHQQALGAPVITEPVGEEDLPPVGDLDLMECLEG
A0A8C5K765_BMF-01       -----MEPPQCVEELEDDV-----------FQPEDEEP-------G----
A0A8C5K765_BMF-02       IFPGEMEPPQCVEELEDDV-----------FQPEDEEP-------G----
A0A8C5KS76_BBC3-01      -MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSC-------GLCEP
A0A8C5P449_BAD-01       -MGTPKKPS---------------------LPPTE--P-------QGVRK
A0A8C5L6N3_BCL2L11      ---MAKQPSDVSSECDREG---------GQLQPAERPP-------QQLRP
A0A8C5L6N3_BCL2L11      ---MAKQPSDVSSECDREG---------GQLQPAERPP-------QQLRP
                                                      .                   

A0A8C5L6N3_BCL2L11      GAP------------------TSLQTVPQ---------------------
A0A8C5KS51_BIK-01       SNQVALRLACIGDEMDLRLRSPRLVQLPGMAMHSLAVTYGQTGVSGVLRS
A0A8C5K765_BMF-01       TQPGSLLSADLFAQSQMDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTL
A0A8C5K765_BMF-02       TQPGSLLSADLFAQSQMDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTL
A0A8C5KS76_BBC3-01      GLP--------AAPAVPALLPAAYLCAPTAPTAVTATLGGSRWPGGPRSR
A0A8C5P449_BAD-01       SEPGIRSLGSDAGGRRWRLAAQSMFQIPEFEPSEQEESSFSERGLGPSPT
A0A8C5L6N3_BCL2L11      GAP------------------TSLQTVPQGNPEGEGDRCPHGSPQGPLAP
A0A8C5L6N3_BCL2L11      GAP------------------TSLQTVPQ---------------------
                                                   *                      

A0A8C5L6N3_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A8C5KS51_BIK-01       LV---------------------------------HGLIDLSKNLRCWSL
A0A8C5K765_BMF-01       SPASPSQGVMLPCGVT-------------------EEPQRLFYGNAGYRL
A0A8C5K765_BMF-02       SPASPSQGVMLPCGVT-------------------EEPQRLFYGNAGYRL
A0A8C5KS76_BBC3-01      PRGPRPD----------------------------GPDLSLSPAEQHLES
A0A8C5P449_BAD-01       GP---------------------------------RQAPGLLGDISYRQR
A0A8C5L6N3_BCL2L11      PASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A8C5L6N3_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
                                                                          

A0A8C5L6N3_BCL2L11      PSPPCQA-------------FNHYLSAMHIQSNPQDQ-------------
A0A8C5KS51_BIK-01       PTPSA---------------------------------WVHRGQVCRQLP
A0A8C5K765_BMF-01       PLPAS------------------FPTGLPLEEQPPEGQWPHR-------A
A0A8C5K765_BMF-02       PLPAS------------------FPTGLPLEEQPPEGQWPHR-------A
A0A8C5KS76_BBC3-01      PVPSAPE---------------------ALEGGPTQAAPGVRGE-----E
A0A8C5P449_BAD-01       PQPSNSSHYGGGGALETRSRHSSYPAGTEEDGGMEEELSPFRGRSRSAPP
A0A8C5L6N3_BCL2L11      PSPPCQA-------------FNHYLSAMASIRQSQEEPTDMR-------P
A0A8C5L6N3_BCL2L11      PSPPCQA-------------FNHYLSAMASIRQSQEEPTDMR-------P
                        * *.                                              

A0A8C5L6N3_BCL2L11      --------------------------------------------------
A0A8C5KS51_BIK-01       PLLL------ALLLLGGALHLLLQ--------------------------
A0A8C5K765_BMF-01       EVQIAR----KLQCIADQFHRL--------HLQQHQQNRDRAWWQVFLFL
A0A8C5K765_BMF-02       EVQIAR----KLQCIADQFHRL--------HLQQHQQNRDRAWWQVFLFL
A0A8C5KS76_BBC3-01      EQWARE-IGAQLRRMADDLNAQYERR----RQEEQQRHRPSPWRVVYNLF
A0A8C5P449_BAD-01       NLWAAQRYGRELRRMSDEFEGSFKG---LPRPKSAGTATQMRQSSSWTRI
A0A8C5L6N3_BCL2L11      EIWIAQ----ELRRIGDEFNAYYPRRVFLNNYQAAEDHPQMVILRLLRYF
A0A8C5L6N3_BCL2L11      EIWIAQ----ELRRIGDEFNAYYPRRVFLNNYQAAEDHPQMVILRLLRYF
                                                                          

A0A8C5L6N3_BCL2L11      ------------------
A0A8C5KS51_BIK-01       ------------------
A0A8C5K765_BMF-01       HNLALNREENRDGAGPR-
A0A8C5K765_BMF-02       HNLALNREENRDGAGPR-
A0A8C5KS76_BBC3-01      MGLLPLPRGPGAPEMEPN
A0A8C5P449_BAD-01       IQSWWDRNLGRGGPAPSQ
A0A8C5L6N3_BCL2L11      VRLVWRRH----------
A0A8C5L6N3_BCL2L11      VRLVWRRH----------
                                          

© 1998-2022Legal notice