Dataset for protein Bim of organism Jaculus jaculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************************                                      
MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQ--------------------------------------
                                          gnpegegdrcphgspqgplappaspgpfatrsplfifv

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  ******************************    :.*::                       
------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMasirqsQeeptdmrpeiwiaqelrrigdefna
rrssllsrsssgyfsfdt                              hiqsnp dq-----------------------

       170       180       190       
....:....|....:....|....:....|....:..
                                     
yyprrvflnnyqaaedhpqmvilrllryfvrlvwrrh
-------------------------------------
© 1998-2022Legal notice