Dataset for protein Bim of organism Jaculus jaculus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C5L6N3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Jaculus jaculus GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFV
RRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPTDMRPEIWIAQELRRIGDEFNA
YYPRRVFLNNYQAAEDHPQMVILRLLRYFVRLVWRRH
>gnl|bcl2dbpro|A0A8C5L6N3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Jaculus jaculus GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQE
EPTDMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPQMVILRLLRYFVRLVWRRH
>gnl|bcl2dbpro|A0A8C5L6N3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Jaculus jaculus GN=BCL2L11 (length=81 residues).
MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMHIQSNPQD
Q
© 1998-2022Legal notice