Dataset for protein Bim of organism Jaculus jaculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5L6N3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQ--------
A0A8C5L6N3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQGNPEGEGD
A0A8C5L6N3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQQLRPGAPTSLQTVPQ--------
                        ******************************************        

A0A8C5L6N3_BCL2L11      ------------------------------------------------DR
A0A8C5L6N3_BCL2L11      RCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDR
A0A8C5L6N3_BCL2L11      ------------------------------------------------DR
                                                                        **

A0A8C5L6N3_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMHIQSNPQDQ-------------
A0A8C5L6N3_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPTDMRPEIWIAQE
A0A8C5L6N3_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPTDMRPEIWIAQE
                        ****************************    :.*::             

A0A8C5L6N3_BCL2L11      -----------------------------------------------
A0A8C5L6N3_BCL2L11      LRRIGDEFNAYYPRRVFLNNYQAAEDHPQMVILRLLRYFVRLVWRRH
A0A8C5L6N3_BCL2L11      LRRIGDEFNAYYPRRVFLNNYQAAEDHPQMVILRLLRYFVRLVWRRH
                                                                       

© 1998-2022Legal notice