Dataset for protein classical BH3-containing proteins of organism Hucho hucho

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mlspspplpmtlhrqnnknsltlildlsyrqqnqsngstiliergkygelnpgggaasgaeptdiplqfsegdqqsrggi
         fptyplslsa ppvsmtd tslnpspsv ptslcprssissy       rls sln  sshpsspp hsml
                        fp  snhfigl t  l    l f   h           h f   lc        fa
                            m                                                   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  :                         .        .                          
--p-sl------spvfrtmsrssdgyfsfdsdsipsspllednkst------qtpspssqimt------hplqrms----
mm-n--lgfqsr------ldht-sdvdeps------eevrktkyedrstttpspglqlhnvllpcgvaqvastllygngr
vintiitplppsmsqmfsiydeh-cftvsp shcwrtafg-ie-dqlggqkhmsegaighnt-      ttrp prpgag
is l  hcgc f l iv  n--e -esine e e  ---- --e  haag gy vf  rvas       emem fa ee 
             a d   aqm  s  dc        tmn kd         n a   ptsi                  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      .    .           * :*. :.*:*     :        
-r-----q--qaqgtgrdyeawpn---------pgapyRprsQptppamwpekliGqqLrrigDeFntwlikg-------
v-lyses-vqsvverrpgvdgqgtmtpteegggdlhsfwvqppsaagdlsaatky re qlms q dhlfdhvvsryttp
l mnfparferlgdqne-t-fmde         r rme ldq  qq  rrm vc  ck        hqehlqr       
f  h    afeql k dn-q-l v           g   s     l  h i i              n    l       
         c h     he v  a               g                                        
                    h                  a                                        

       250       260       270       280      
....:....|....:....|....:....|....:....|....:.
              .        . :                    
--elrrrnsqgaqkqlv-shqwpafLfsmkelegrllq-i------
alyppgvrnpvplwnrqqmssewtyilwqgltitgh--i-lqrrse
  hmknqkamrgaawmtkargllsl wepeaia egtptwrp s  
  shvygikaleiprks dpanfp  qkhhhs-  erag pr    
  r a thgg  gg il  dd a        f   vsi        
            e  e               a              
© 1998-2020Legal notice