Dataset for protein classical BH3-containing proteins of organism Hucho hucho

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .          :       
--------------------------------iergkdgelnpg--aas-aepteipqsdeg-dqtsrggimlpnsllgf
mtlhrqnnknsltlildlsyrqqnqsngstilmd---ydvse-dgg---rtafrd-kyfsrslttqpspefpmhtnmt--
            ma mttisnhnippsvqmft--hth-c-f-n-sshcwge----t--eqla ggshyvvlqisvvt-pc
               ind mhcgcgfml it  sdees- dvcs  ml p-tvspnetyph  sakgptsga rhasf s
                   i       a     n r  s -h p      spmn kdkdc   a   nsa   g      
                                         d e         l f e         m            
                                                     g                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           .                    
qs-spv-------------------------------------tqtpspssqvrthslqrmsqaqetrrd----------
--r-tpslcplsfrtlsrsssgyfsfdlsdsipsspllkdnksstrfygngrimlyaesqvfsvvgrnp-pseevgetek
gvtqet       is ypl phl pls hp s p hsflvsplrpllr gagfvmvfpa ferqgdqgsn          
l a vm                                     em  l pessidn m  lqtls seeh          
     l                                      l  a e  l       aceil k dg          
                                                               h     e          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    .    .      
------------------------------------------------yeawpn---------pgapyRprsQptppamw
dqlaagkgmtggpighaltvpemrlagegrlrmnsesqaqelqgrgpgvdgqgtmtpteegggdlhsfwvqppsaagdls
                                                t-fmde         r rme ldq  qq  rr
                                                -q-l v           g   s     l  h 
                                                e v  a               g          
                                                  h                  a          
                                                                                

       250       260       270       280       290       300       310      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
     * :*. :.*:*     :                      .        . :                    
pekliGqqLrrigDeFntwlikg---------elrrrnsqgaqkqlv-shqwpafLfsmkelegrllq-i------
aatky re qlms q dhlfdhvvsryttpalyppgvrnpvplwnrqqmssewtyilwqgltitgh--i-lqrrse
m vc  ck        hqehlqr         hmknqkamrgaawmtkargllsl wepeaia egtptwrp s  
i i              n    l         shvygikaleiprks dpanfp  qkhhhs-  erag pr    
                                r a thgg  gg il  dd a        f   vsi        
                                          e  e               a              
                                                                            
© 1998-2020Legal notice