Dataset for protein classical BH3-containing proteins of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5NF23_BCL2L11      ----------------------------MNHNIGPNVSTTLIERRKSGES
A0A4W5R3N6_BCL2L11      ------------------------MTDSSRQQNQSNGSTILIERGKYGEL
A0A4W5JLL9_BAD-02       MLSPSPPLPFPTYPLSLSASPPVSFPLSTSLFPSLSTSPLSLCPLSFISL
A0A4W5R3N6_BCL2L11      ---------MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGEL
A0A4W5R3N6_BCL2L11      ---------MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGEL
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A4W5R1T6_BAD-01       --------------------------------------------------
                                                                          

A0A4W5NF23_BCL2L11      HPGGGAASRAEPSDNP-QSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLY
A0A4W5R3N6_BCL2L11      NPGGGAASGAEPTDIP-QFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLS
A0A4W5JLL9_BAD-02       YP-------LSPHLFPLSLHPSSPPSHSFLVSPLSLTPLPPSSSVDVSMA
A0A4W5R3N6_BCL2L11      NPGGGAASGAEPTDIP-QFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLS
A0A4W5R3N6_BCL2L11      NPGGGAASGAEPTDIP-QFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLS
A0A4W5MZR2_BAD-01       ------------------------------------------------MD
A0A4W5N3A7_BMF-01       ------------------------------------------------MD
A0A4W5N721_BMF-01       ------------------------------------------------MD
A0A4W5JLL9_BAD-01       ------------------------------------------MAQMFTIS
A0A4W5R1T6_BAD-01       ----------------------------MAIINTIIHCGCPFSLQIFTMN
                                                                        : 

A0A4W5NF23_BCL2L11      RSSSGYFSFDSDSIPSSPLLKDNKST------QTPSPSSQVIT------H
A0A4W5R3N6_BCL2L11      RSSSGYFSFDSDSIPSSPLLKDNKST------QTPSPSSQIMT------H
A0A4W5JLL9_BAD-02       QM---FTISDSESEPSEEVGETEKDQLAAGKGMTGGPIGHALT------V
A0A4W5R3N6_BCL2L11      RSSSGYFSFDSDSIPSSPLLKDNKST------QTPSPSSQIMT------H
A0A4W5R3N6_BCL2L11      RSSSGYFSFDSDSIPSSPLLKDNKST------QTPSPSSQIMT------H
A0A4W5MZR2_BAD-01       HTHDCVDECE--------------SDHSGTTHNSEFQLHVST-------T
A0A4W5N3A7_BMF-01       DEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALRNNMLPCG---E
A0A4W5N721_BMF-01       DEEDDVFEPD-SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQE
A0A4W5JLL9_BAD-01       ---DSESEPS------EEVGETEKDQLAAGKGMTGGPIGHALT------V
A0A4W5R1T6_BAD-01       HTHDCVDDNP------ETMNEKDESDHSGTTHYPEFQLHTVST------T
                                                .        .                

A0A4W5NF23_BCL2L11      ALQRLS--------------RALETRRDYDVWPN---------PLRPYRA
A0A4W5R3N6_BCL2L11      ALQRMS--------------QAQETNRDYDAWPN---------PLHPYRP
A0A4W5JLL9_BAD-02       PEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPT---------DGASFRV
A0A4W5R3N6_BCL2L11      ALQRMS--------------QAQETNRDYDAWPN---------PLHPYRP
A0A4W5R3N6_BCL2L11      ALQRMS--------------QAQETNRDYDAWPN---------PLHPYRP
A0A4W5MZR2_BAD-01       MSTRPRPGERVRLYSESQVCSQVGKRENTEFQDVMTPTEEGGGDGASFRG
A0A4W5N3A7_BMF-01       PRPLFYGNAGFRLHFPARFEQVGDQGPHEQHQGE---------RGRMEWL
A0A4W5N721_BMF-01       PRPLFYGNAGFRLHFPAQFERVGDQGP----LGE---------RGGMERL
A0A4W5JLL9_BAD-01       PEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPT---------DGASFRV
A0A4W5R1T6_BAD-01       TSTRPRPGGRVRLYSESQVFSHVGRRDDTEFQDAMTPTEEGGGDGAPFRS
                                                                        . 

A0A4W5NF23_BCL2L11      RPPPTAGDMRPEILIGQELRRIGDEFNNLFIHR---------RLAGRNGQ
A0A4W5R3N6_BCL2L11      RPQPTAGDMWPETLIGQELQRIGDEFNHLFIHG---------HLPGRNAQ
A0A4W5JLL9_BAD-02       RSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKG---------EMRRVKSA
A0A4W5R3N6_BCL2L11      RPQPTAGDMWPETLIGQELQRIGDEFNHLFIHG---------HLPGRNAQ
A0A4W5R3N6_BCL2L11      RPQPTAGDMWPETLIGQELQRIGDEFNHLFIHGVSRYTTPALSLVYTHKG
A0A4W5MZR2_BAD-01       RSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKG---------EPKRGISP
A0A4W5N3A7_BMF-01       QQQPQQPAHSMEVCIGQKLQLIGDQFHQEHLQL---------YHRNQRNM
A0A4W5N721_BMF-01       DQQPQLPARSIEVCIGQKLQLIGDQFHQEHLQV---------YHRNQRNM
A0A4W5JLL9_BAD-01       RSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKG---------EMRRVKSA
A0A4W5R1T6_BAD-01       RSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKG---------EPKRGISP
                           .           * :*. :.*:*     :                  

A0A4W5NF23_BCL2L11      VAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR--
A0A4W5R3N6_BCL2L11      VAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR--
A0A4W5JLL9_BAD-02       GAAKQMTKSPSWWAYLFSHKETETEHTPTIPPRSSE
A0A4W5R3N6_BCL2L11      VAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR--
A0A4W5R3N6_BCL2L11      LEEPQISKDDDNAPYIQKMHHF-GRVSI--------
A0A4W5MZR2_BAD-01       GGGKQKV-SRGWFSFLWSPKEAEGRE----------
A0A4W5N3A7_BMF-01       RPLWWRV-ASALLTLLFEQEAIAGGGRAGWR-----
A0A4W5N721_BMF-01       RPLWRRL-ASALLTLLFEQEAIAGGGRAGWR-----
A0A4W5JLL9_BAD-01       GAAKQMTKSPSWWAYLFSHKETETEHTPTIPPRSSE
A0A4W5R1T6_BAD-01       GGIKQEV-SRGWFSFLWSPKESEGRE----------
                            .        . :                    

© 1998-2020Legal notice