Dataset for protein classical BH3-containing proteins of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5JLL9_BAD-02       ----------------------------------------------MLSP
A0A4W5R3N6_BCL2L11      MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASG
A0A4W5R3N6_BCL2L11      MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASG
A0A4W5NF23_BCL2L11      -------------------MNHNIGPNVSTTLIERRKSGESHPGGGAASR
A0A4W5R3N6_BCL2L11      ---------------MTDSSRQQNQSNGSTILIERGKYGELNPGGGAASG
A0A4W5MZR2_BAD-01       --------------------------------MDHTHDCVDECE------
A0A4W5N3A7_BMF-01       --------------------------------MDDEEDDVFVPDSSHCWR
A0A4W5N721_BMF-01       --------------------------------MDDEEDDVFEPD-SHCWR
A0A4W5JLL9_BAD-01       --------------------------MAQMFTIS---DSESEPS------
A0A4W5R1T6_BAD-01       ------------MAIINTIIHCGCPFSLQIFTMNHTHDCVDDNP------
                                                                          

A0A4W5JLL9_BAD-02       SPPLPFPTYPLSLSASPPVSFPLSTSLFPSLSTSPLSLCPLSFISLYPLS
A0A4W5R3N6_BCL2L11      AEPTDIPQFSEG-DQQSRGGIMMPNSLLGFQSRSPV------FRTLSRSS
A0A4W5R3N6_BCL2L11      AEPTDIPQFSEG-DQQSRGGIMMPNSLLGFQSRSPV------FRTLSRSS
A0A4W5NF23_BCL2L11      AEPSDNPQSCEG-DQQSRGGIMIPNSLLGFQSRSPV------FRTLYRSS
A0A4W5R3N6_BCL2L11      AEPTDIPQFSEG-DQQSRGGIMMPNSLLGFQSRSPV------FRTLSRSS
A0A4W5MZR2_BAD-01       --------SDHS-GTTHNSEFQLHVST-------TM--------------
A0A4W5N3A7_BMF-01       TAFREIKYEDRG-TQTPSPALALRNNMLPCG---EP--------------
A0A4W5N721_BMF-01       TAFREIKYEDRG-TQTPSPVLPLPNNMLPCGVAQEP--------------
A0A4W5JLL9_BAD-01       EEVGETEKDQLA-AGKGMTGGPIGHALT------VP--------------
A0A4W5R1T6_BAD-01       ETMNEKDESDHS-GTTHYPEFQLHTVST------TT--------------
                                   .          :                           

A0A4W5JLL9_BAD-02       PHLFPLSLHPSSPPSHSFLVSPLSLTPLPPSSSVDVSMAQMFTISDSESE
A0A4W5R3N6_BCL2L11      SGYFSFD-SDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRD
A0A4W5R3N6_BCL2L11      SGYFSFD-SDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRD
A0A4W5NF23_BCL2L11      SGYFSFD-SDSIPSSPLLKDNKSTQTPSPSSQVITHALQRLSRALETRRD
A0A4W5R3N6_BCL2L11      SGYFSFD-SDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRD
A0A4W5MZR2_BAD-01       -----------------------STRPRPGERVRLYSESQVCSQVGKREN
A0A4W5N3A7_BMF-01       -----------------------RPLFYGNAGFRLHFPARFEQVGDQGPH
A0A4W5N721_BMF-01       -----------------------RPLFYGNAGFRLHFPAQFERVGDQGP-
A0A4W5JLL9_BAD-01       -----------------------EMRLAGEGRLRMNSESQAQELQGRGPG
A0A4W5R1T6_BAD-01       -----------------------STRPRPGGRVRLYSESQVFSHVGRRDD
                                                               .          

A0A4W5JLL9_BAD-02       PSEEVGETEKDQLAAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQ
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A4W5R1T6_BAD-01       --------------------------------------------------
                                                                          

A0A4W5JLL9_BAD-02       ELQGRGPGVEGMPT---------DGASFRVRSQSAPPALWAAKKYGRQLR
A0A4W5R3N6_BCL2L11      --------YDAWPN---------PLHPYRPRPQPTAGDMWPETLIGQELQ
A0A4W5R3N6_BCL2L11      --------YDAWPN---------PLHPYRPRPQPTAGDMWPETLIGQELQ
A0A4W5NF23_BCL2L11      --------YDVWPN---------PLRPYRARPPPTAGDMRPEILIGQELR
A0A4W5R3N6_BCL2L11      --------YDAWPN---------PLHPYRPRPQPTAGDMWPETLIGQELQ
A0A4W5MZR2_BAD-01       --------TEFQDVMTPTEEGGGDGASFRGRSQSAPPALWAAKKYGCQLR
A0A4W5N3A7_BMF-01       --------EQHQGE---------RGRMEWLQQQPQQPAHSMEVCIGQKLQ
A0A4W5N721_BMF-01       -----------LGE---------RGGMERLDQQPQLPARSIEVCIGQKLQ
A0A4W5JLL9_BAD-01       --------VEGMPT---------DGASFRVRSQSAPPALWAAKKYGRQLR
A0A4W5R1T6_BAD-01       --------TEFQDAMTPTEEGGGDGAPFRSRSQSAPPALWAAKKYGRQLR
                                                    .    .           * :*.

A0A4W5JLL9_BAD-02       RMSDEFDTWLDKG---------EMRRVKSAGAAKQMTKSPSWWAYLFSHK
A0A4W5R3N6_BCL2L11      RIGDEFNHLFIHG---------HLPGRNAQVAQANLQQMHQEPAFLLWMG
A0A4W5R3N6_BCL2L11      RIGDEFNHLFIHGVSRYTTPALSLVYTHKGLEEPQISKDDDNAPYIQKMH
A0A4W5NF23_BCL2L11      RIGDEFNNLFIHR---------RLAGRNGQVAQGNLQQMHQEPAFLLWMG
A0A4W5R3N6_BCL2L11      RIGDEFNHLFIHG---------HLPGRNAQVAQANLQQMHQEPAFLLWMG
A0A4W5MZR2_BAD-01       RMSDEFDTWLDKG---------EPKRGISPGGGKQKV-SRGWFSFLWSPK
A0A4W5N3A7_BMF-01       LIGDQFHQEHLQL---------YHRNQRNMRPLWWRV-ASALLTLLFEQE
A0A4W5N721_BMF-01       LIGDQFHQEHLQV---------YHRNQRNMRPLWRRL-ASALLTLLFEQE
A0A4W5JLL9_BAD-01       RMSDEFDTWLDKG---------EMRRVKSAGAAKQMTKSPSWWAYLFSHK
A0A4W5R1T6_BAD-01       RMSDEFDTWLDKG---------EPKRGISPGGIKQEV-SRGWFSFLWSPK
                         :.*:*     :                      .        . :    

A0A4W5JLL9_BAD-02       ETETEHTPTIPPRSSE
A0A4W5R3N6_BCL2L11      LLIGRLLQIILQRR--
A0A4W5R3N6_BCL2L11      HF-GRVSI--------
A0A4W5NF23_BCL2L11      LLIGRLLQIILRRR--
A0A4W5R3N6_BCL2L11      LLIGRLLQIILQRR--
A0A4W5MZR2_BAD-01       EAEGRE----------
A0A4W5N3A7_BMF-01       AIAGGGRAGWR-----
A0A4W5N721_BMF-01       AIAGGGRAGWR-----
A0A4W5JLL9_BAD-01       ETETEHTPTIPPRSSE
A0A4W5R1T6_BAD-01       ESEGRE----------
                                        

© 1998-2020Legal notice