Dataset for protein classical BH3-containing proteins of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A4W5JLL9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=161 residues).
MAQMFTISDSESEPSEEVGETEKDQLAAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGA
SFRVRSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETETEHTPTIPPRSS
E
>gnl|bcl2dbpro|A0A4W5JLL9_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=252 residues).
MLSPSPPLPFPTYPLSLSASPPVSFPLSTSLFPSLSTSPLSLCPLSFISLYPLSPHLFPLSLHPSSPPSHSFLVSPLSLT
PLPPSSSVDVSMAQMFTISDSESEPSEEVGETEKDQLAAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRG
PGVEGMPTDGASFRVRSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETET
EHTPTIPPRSSE
>gnl|bcl2dbpro|A0A4W5MZR2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=147 residues).
MDHTHDCVDECESDHSGTTHNSEFQLHVSTTMSTRPRPGERVRLYSESQVCSQVGKRENTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A4W5N3A7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Hucho hucho GN=BMF (length=161 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALRNNMLPCGEPRPLFYGNAGFRLHFPARFEQVGDQGPHEQH
QGERGRMEWLQQQPQQPAHSMEVCIGQKLQLIGDQFHQEHLQLYHRNQRNMRPLWWRVASALLTLLFEQEAIAGGGRAGW
R
>gnl|bcl2dbpro|A0A4W5N721_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Hucho hucho GN=BMF (length=159 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLDQQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVYHRNQRNMRPLWRRLASALLTLLFEQEAIAGGGRAGWR
>gnl|bcl2dbpro|A0A4W5NF23_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=211 residues).
MNHNIGPNVSTTLIERRKSGESHPGGGAASRAEPSDNPQSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLYRSSSGYFSF
DSDSIPSSPLLKDNKSTQTPSPSSQVITHALQRLSRALETRRDYDVWPNPLRPYRARPPPTAGDMRPEILIGQELRRIGD
EFNNLFIHRRLAGRNGQVAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
>gnl|bcl2dbpro|A0A4W5R1T6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=176 residues).
MAIINTIIHCGCPFSLQIFTMNHTHDCVDDNPETMNEKDESDHSGTTHYPEFQLHTVSTTTSTRPRPGGRVRLYSESQVF
SHVGRRDDTEFQDAMTPTEEGGGDGAPFRSRSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGIKQEVSR
GWFSFLWSPKESEGRE
>gnl|bcl2dbpro|A0A4W5R3N6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=215 residues).
MTDSSRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDIPQFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLSRSSSG
YFSFDSDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPQPTAGDMWPETLIGQELQ
RIGDEFNHLFIHGHLPGRNAQVAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A4W5R3N6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=230 residues).
MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDIPQFSEGDQQSRGGIMMPNSLLGFQ
SRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPQPT
AGDMWPETLIGQELQRIGDEFNHLFIHGHLPGRNAQVAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A4W5R3N6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=232 residues).
MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDIPQFSEGDQQSRGGIMMPNSLLGFQ
SRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPQPT
AGDMWPETLIGQELQRIGDEFNHLFIHGVSRYTTPALSLVYTHKGLEEPQISKDDDNAPYIQKMHHFGRVSI
© 1998-2020Legal notice