Dataset for protein Bad of organism Hucho hucho

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mlspspplpfptyplslsasppvsfplstslfpslstsplslcplsfislyplsphlfplslhpssppshsflvsplsnt
                                                                          maiil 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              :    *. .:         :.: :. .  .   :  . *. . *     *:*: ****. .  *. 
----------qmftmshthDsvsepseevgeteksqlsgtthmtggqlghvsTvpstRprpggRvRmySESQvqslvGrr
plppsssvsv----in--- ceddn--------eddhaagkgysefpi-tal ttem lagee l ln    afeqq kg
iihcgcpfmlsiaq ftis     cp tmn kd         np        m                  c    
        da     d                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ..*   .         ***.** **************** ***************** .*  *.*. ** . * .*:::
pgvEgqpt---------DGAsFRvRSQSAPPALWAAKKYGrQLRRMSDEFDTWLDKGEprRvkSpGgaKQmv-SrsWwsy
ent fmdvmtpteeggg   p  s                c                 mk gi a ai  ktk pg faf
d    a               g                                           g  e         
                                                                                

       250       260 
....:....|....:....|.
*:* **:*             
LwSpKEtEtrh----------
 f h  s geetptipprsse
      a              
                     
© 1998-2020Legal notice