Dataset for protein Bad of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5JLL9_BAD-02      MLSPSPPLPFPTYPLSLSASPPVSFPLSTSLFPSLSTSPLSLCPLSFISL
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
                                                                         

A0A4W5JLL9_BAD-02      YPLSPHLFPLSLHPSSPPSHSFLVSPLSLTPLPPSSSVDVSMAQMFTISD
A0A4W5MZR2_BAD-01      --------------------------------------------MDHTHD
A0A4W5JLL9_BAD-01      --------------------------------------MAQMFTIS---D
A0A4W5R1T6_BAD-01      ------------------------MAIINTIIHCGCPFSLQIFTMNHTHD
                                                                   :    *

A0A4W5JLL9_BAD-02      SESEPSEEVGETEKDQLAAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSE
A0A4W5MZR2_BAD-01      CVDEC--------ESDHSGTTHNSEFQL-HVSTTMSTRPRPGERVRLYSE
A0A4W5JLL9_BAD-01      SESEPSEEVGETEKDQLAAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSE
A0A4W5R1T6_BAD-01      CVDDNPETMNEKDESDHSGTTHYPEFQLHTVSTTTSTRPRPGGRVRLYSE
                       . .:         :.: :. .  .   :  . *. . *     *:*: **

A0A4W5JLL9_BAD-02      SQAQELQGRGPGVEGMPT---------DGASFRVRSQSAPPALWAAKKYG
A0A4W5MZR2_BAD-01      SQVCSQVGKRENTEFQDVMTPTEEGGGDGASFRGRSQSAPPALWAAKKYG
A0A4W5JLL9_BAD-01      SQAQELQGRGPGVEGMPT---------DGASFRVRSQSAPPALWAAKKYG
A0A4W5R1T6_BAD-01      SQVFSHVGRRDDTEFQDAMTPTEEGGGDGAPFRSRSQSAPPALWAAKKYG
                       **. .  *.  ..*   .         ***.** ****************

A0A4W5JLL9_BAD-02      RQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETETE
A0A4W5MZR2_BAD-01      CQLRRMSDEFDTWLDKGEPKRGISPGGGKQKV-SRGWFSFLWSPKEAEGR
A0A4W5JLL9_BAD-01      RQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETETE
A0A4W5R1T6_BAD-01      RQLRRMSDEFDTWLDKGEPKRGISPGGIKQEV-SRGWFSFLWSPKESEGR
                        ***************** .*  *.*. ** . * .*:::*:* **:*  

A0A4W5JLL9_BAD-02      HTPTIPPRSSE
A0A4W5MZR2_BAD-01      E----------
A0A4W5JLL9_BAD-01      HTPTIPPRSSE
A0A4W5R1T6_BAD-01      E----------
                                  

© 1998-2020Legal notice