Dataset for protein Bad of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A4W5JLL9_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=252 residues).
MLSPSPPLPFPTYPLSLSASPPVSFPLSTSLFPSLSTSPLSLCPLSFISLYPLSPHLFPLSLHPSSPPSHSFLVSPLSLT
PLPPSSSVDVSMAQMFTISDSESEPSEEVGETEKDQLAAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRG
PGVEGMPTDGASFRVRSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETET
EHTPTIPPRSSE
>gnl|bcl2dbpro|A0A4W5JLL9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=161 residues).
MAQMFTISDSESEPSEEVGETEKDQLAAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGA
SFRVRSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETETEHTPTIPPRSS
E
>gnl|bcl2dbpro|A0A4W5MZR2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=147 residues).
MDHTHDCVDECESDHSGTTHNSEFQLHVSTTMSTRPRPGERVRLYSESQVCSQVGKRENTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A4W5R1T6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hucho hucho GN=BAD (length=176 residues).
MAIINTIIHCGCPFSLQIFTMNHTHDCVDDNPETMNEKDESDHSGTTHYPEFQLHTVSTTTSTRPRPGGRVRLYSESQVF
SHVGRRDDTEFQDAMTPTEEGGGDGAPFRSRSQSAPPALWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGIKQEVSR
GWFSFLWSPKESEGRE
© 1998-2020Legal notice