Dataset for protein classical BH3-containing proteins of organism Heterocephalus glaber

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     .       :   *     *      * ..:   :         
-----------------------------------makqpsdvscecdrEggqlqPaerppqLrpgaptslqtepq----
mrtpenpspaptnaeglrklelgirrlesaqsmfqipefepseqedsss erayg tptgdr gtsslggflgdishqqr
                                   -msearp tr llm tll e l g- l a    avmhpfrggnpe
                                                                            edls

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        .         . :. *        
--------------------------------------------------------drspapmscdkstqtPsppcqafn
qspsvrhhrcphgspqgplappaspgpfatrsplfifvrrssllsrsssgyfsfdtggtgltetrsrhssy tgmeeeag
gliesegdg le  slma rlacig                                emd rlrap la l gravhsla
ppgdtdlv                                                                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .                                                                            
hylsamasmrqsrseppdmrp--eiwiaqelrrigdefnasyprrvflnnyqpaedlpqmvi--ll-----l--------
mkeepspfrgr-qaa--nlwalraqr------------vd-fkglprsksagt-tkhw-ssslr--ryivr-vqggpagr
ity q g----l---t ----  ---ygr    ms pw--la hswvpp----r----v---vl  gilrl l       
       lw v   l  g ts  dm             gh   ealh cgwac ql   vll                  

       250       260    
....:....|....:....|....
                        
--wrmh------------------
qg-traiqswwdrnlgrggsapsq
   ---plpplppggppp qlc f
   sls                  
© 1998-2020Legal notice