Dataset for protein classical BH3-containing proteins of organism Heterocephalus glaber

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G5B6Q3_BAD-02          --------------------------------MFQIPEFEPSEQEDSSSE
G5B6Q3_BAD-01          MRTPENPSPAPTNAEGLRKLELGIRRLESAQSMFQIPEFEPSEQEDSSSE
G5BM80_BIK-01          ------------------------------------MSEARPVTRDLLME
G5BQZ0_BCL2L11-02      -----------------------------------MAKQPSDVSCECDRE
G5BQZ0_BCL2L11-01      -----------------------------------MAKQPSDVSCECDRE
G5BQZ0_BCL2L11-04      -----------------------------------MAKQPSDVSCECDRE
G5BQZ0_BCL2L11-03      -----------------------------------MAKQPSDVSCECDRE
                                                            .       :   *

G5B6Q3_BAD-02          ERALGPTPTGDRLGPSSPGGFLGDISHQQRQLISSRHH------------
G5B6Q3_BAD-01          ERALGPTPTGDRLGPSSPGGFLGDISHQQRQLISSRHH------------
G5BM80_BIK-01          TLLYEPLPG-PLLATGALAVMHPFRGEDLSPPGDTDLVGCLEGSSLMALR
G5BQZ0_BCL2L11-02      GGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPEVEGDRCPHGSPQGPLA
G5BQZ0_BCL2L11-01      GGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPEVEGDRCPHGSPQGPLA
G5BQZ0_BCL2L11-04      GGQLQPAERPPQLRPGAPTSLQTEPQ------------------------
G5BQZ0_BCL2L11-03      GGQLQPAERPPQLRPGAPTSLQTEPQ------------------------
                            *      * ..:   :                             

G5B6Q3_BAD-02          ------------------------------------GGTGATETRSRHSS
G5B6Q3_BAD-01          ------------------------------------GGTGATETRSRHSS
G5BM80_BIK-01          LACIG-------------------------------DEMDLRLRAPRLAQ
G5BQZ0_BCL2L11-02      PPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
G5BQZ0_BCL2L11-01      PPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
G5BQZ0_BCL2L11-04      ------------------------------------DRSPAPMSCDKSTQ
G5BQZ0_BCL2L11-03      ------------------------------------DRSPAPMSCDKSTQ
                                                           .         . :.

G5B6Q3_BAD-02          YPTGMEEEAGMKEEPSPFRGRSRSAPPNLWA--AQRYGRELRRMSDEFVD
G5B6Q3_BAD-01          YPTGMEEEAGMKEEPSPFRGRSRSAPPNLWA--AQRYGRELRRMSDEFVD
G5BM80_BIK-01          LPGRAVHSLAITYSQMGLWGVLRSLTPGLTSLRDMW----------PWGH
G5BQZ0_BCL2L11-02      TPSPPCQAFNHYLSAMASMRQSQAEPPDMRP--EIWIAQELRRIGDEFNA
G5BQZ0_BCL2L11-01      TPSPPCQAFNHYLSAMASMRQSQAEPPDMRP--EIWIAQELRRIGDEFNA
G5BQZ0_BCL2L11-04      TPSPPCQAFNHYLSAMG---------------------------------
G5BQZ0_BCL2L11-03      TPSPPCQAFNHYLSAMASMRQSQAEPPDMRP--EIWIAQELRRIGDEFNA
                        *           .                                    

G5B6Q3_BAD-02          SFKGLPRPKSAGTATKLWQSSS--------------------WTRAIQSW
G5B6Q3_BAD-01          SFKGLPRPKSAGTATKLWQSSS--------------------WTRAIQSW
G5BM80_BIK-01          LAPHAWVSPGWACRQLLPVVLLVLLLGILRLLLQGGPAGRQGWSLSPLPP
G5BQZ0_BCL2L11-02      SYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLV---------WRMH----
G5BQZ0_BCL2L11-01      SYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLV---------WRMH----
G5BQZ0_BCL2L11-04      -YPESLHSC-----------------------------------------
G5BQZ0_BCL2L11-03      SYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLV---------WRMH----
                                                                         

G5B6Q3_BAD-02          WDRNLGRGGSAPSQ
G5B6Q3_BAD-01          WDRNLGRGGSAPSQ
G5BM80_BIK-01          LPPGGPPPGQLCSF
G5BQZ0_BCL2L11-02      --------------
G5BQZ0_BCL2L11-01      --------------
G5BQZ0_BCL2L11-04      --------------
G5BQZ0_BCL2L11-03      --------------
                                     

© 1998-2020Legal notice