Dataset for protein classical BH3-containing proteins of organism Heterocephalus glaber

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G5B6Q3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Heterocephalus glaber GN=BAD (length=194 residues).
MRTPENPSPAPTNAEGLRKLELGIRRLESAQSMFQIPEFEPSEQEDSSSEERALGPTPTGDRLGPSSPGGFLGDISHQQR
QLISSRHHGGTGATETRSRHSSYPTGMEEEAGMKEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKS
AGTATKLWQSSSWTRAIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|G5B6Q3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Heterocephalus glaber GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSEERALGPTPTGDRLGPSSPGGFLGDISHQQRQLISSRHHGGTGATETRSRHSSYPTGMEEEAG
MKEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQSSSWTRAIQSWWDRNLGRGGSAP
SQ
© 1998-2020Legal notice