Dataset for protein classical BH3-containing proteins of organism Heterocephalus glaber

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|G5B6Q3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Heterocephalus glaber GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSEERALGPTPTGDRLGPSSPGGFLGDISHQQRQLISSRHHGGTGATETRSRHSSYPTGMEEEAG
MKEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQSSSWTRAIQSWWDRNLGRGGSAP
SQ
>gnl|bcl2dbpro|G5B6Q3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Heterocephalus glaber GN=BAD (length=194 residues).
MRTPENPSPAPTNAEGLRKLELGIRRLESAQSMFQIPEFEPSEQEDSSSEERALGPTPTGDRLGPSSPGGFLGDISHQQR
QLISSRHHGGTGATETRSRHSSYPTGMEEEAGMKEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKS
AGTATKLWQSSSWTRAIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|G5BM80_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Heterocephalus glaber GN=BIK (length=186 residues).
MSEARPVTRDLLMETLLYEPLPGPLLATGALAVMHPFRGEDLSPPGDTDLVGCLEGSSLMALRLACIGDEMDLRLRAPRL
AQLPGRAVHSLAITYSQMGLWGVLRSLTPGLTSLRDMWPWGHLAPHAWVSPGWACRQLLPVVLLVLLLGILRLLLQGGPA
GRQGWSLSPLPPLPPGGPPPGQLCSF
>gnl|bcl2dbpro|G5BQZ0_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL2L11 (length=80 residues).
MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGYPESLHSC
>gnl|bcl2dbpro|G5BQZ0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL2L11 (length=200 residues).
MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPEVEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPPDMRPEIWIAQELRRIGDE
FNASYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|G5BQZ0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL2L11 (length=200 residues).
MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPEVEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPPDMRPEIWIAQELRRIGDE
FNASYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|G5BQZ0_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL2L11 (length=140 residues).
MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PPDMRPEIWIAQELRRIGDEFNASYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLVWRMH
© 1998-2020Legal notice