Dataset for protein Bad of organism Gouania willdenowi

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *************************************************************************
-------MAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGLTGPGRIRVNSESVSSTVSRDEEEVGTPTDG
mmpfyvk                                                                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
APFRGRSKSAPPSLWAAKKYGQRLRRMSDEFDSLLDKGEMRKVRSAGSTKQMHHSKSWWSYLFSHQEMEGENNHHDGHTP
                                                                                

    
....
****
ERTE
    
© 1998-2022Legal notice