Dataset for protein Bad of organism Gouania willdenowi

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C5I9J2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gouania willdenowi GN=BAD (length=157 residues).
MAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGLTGPGRIRVNSESVSSTVSRDEEEVGTPTDGAPFRGRS
KSAPPSLWAAKKYGQRLRRMSDEFDSLLDKGEMRKVRSAGSTKQMHHSKSWWSYLFSHQEMEGENNHHDGHTPERTE
>gnl|bcl2dbpro|A0A8C5I9J2_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gouania willdenowi GN=BAD (length=164 residues).
MMPFYVKMAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGLTGPGRIRVNSESVSSTVSRDEEEVGTPTDG
APFRGRSKSAPPSLWAAKKYGQRLRRMSDEFDSLLDKGEMRKVRSAGSTKQMHHSKSWWSYLFSHQEMEGENNHHDGHTP
ERTE
© 1998-2022Legal notice