Dataset for protein Bad of organism Gouania willdenowi

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5I9J2_BAD-01      -------MAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGL
A0A8C5I9J2_BAD-02      MMPFYVKMAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGL
                              *******************************************

A0A8C5I9J2_BAD-01      TGPGRIRVNSESVSSTVSRDEEEVGTPTDGAPFRGRSKSAPPSLWAAKKY
A0A8C5I9J2_BAD-02      TGPGRIRVNSESVSSTVSRDEEEVGTPTDGAPFRGRSKSAPPSLWAAKKY
                       **************************************************

A0A8C5I9J2_BAD-01      GQRLRRMSDEFDSLLDKGEMRKVRSAGSTKQMHHSKSWWSYLFSHQEMEG
A0A8C5I9J2_BAD-02      GQRLRRMSDEFDSLLDKGEMRKVRSAGSTKQMHHSKSWWSYLFSHQEMEG
                       **************************************************

A0A8C5I9J2_BAD-01      ENNHHDGHTPERTE
A0A8C5I9J2_BAD-02      ENNHHDGHTPERTE
                       **************

© 1998-2022Legal notice