Dataset for protein Bim of organism Gopherus evgoodei

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MKQTRRDRGLARGGSWAWWRWRVGALRSAWINSPALRRGWLCPRWGGFHRHVALGRRQEKDQMAKQPSDLNSECDREGGQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************                              ************************
FQSTERPSQPQHLRPGAPTSIQTQYQ------------------------------ASRWESPSIREDMQPEIWIAQELR
                          drspapmscdkstqtpsppcqafnhylsam                        

       170       180       190       200  
....:....|....:....|....:....|....:....|..
******************************************
RIGDEFNASYCPRRGFLDNPAVNHQIVLRLLRYIIRLIWRLQ
                                          
© 1998-2022Legal notice