Dataset for protein Bim of organism Gopherus evgoodei

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4VJX6_BCL2L11      MKQTRRDRGLARGGSWAWWRWRVGALRSAWINSPALRRGWLCPRWGGFHR
A0A8C4VJX6_BCL2L11      MKQTRRDRGLARGGSWAWWRWRVGALRSAWINSPALRRGWLCPRWGGFHR
                        **************************************************

A0A8C4VJX6_BCL2L11      HVALGRRQEKDQMAKQPSDLNSECDREGGQFQSTERPSQPQHLRPGAPTS
A0A8C4VJX6_BCL2L11      HVALGRRQEKDQMAKQPSDLNSECDREGGQFQSTERPSQPQHLRPGAPTS
                        **************************************************

A0A8C4VJX6_BCL2L11      IQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSIREDMQ
A0A8C4VJX6_BCL2L11      IQTQYQ------------------------------ASRWESPSIREDMQ
                        ******                              **************

A0A8C4VJX6_BCL2L11      PEIWIAQELRRIGDEFNASYCPRRGFLDNPAVNHQIVLRLLRYIIRLIWR
A0A8C4VJX6_BCL2L11      PEIWIAQELRRIGDEFNASYCPRRGFLDNPAVNHQIVLRLLRYIIRLIWR
                        **************************************************

A0A8C4VJX6_BCL2L11      LQ
A0A8C4VJX6_BCL2L11      LQ
                        **

© 1998-2022Legal notice