Dataset for protein Bim of organism Gopherus evgoodei

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4VJX6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL2L11 (length=202 residues).
MKQTRRDRGLARGGSWAWWRWRVGALRSAWINSPALRRGWLCPRWGGFHRHVALGRRQEKDQMAKQPSDLNSECDREGGQ
FQSTERPSQPQHLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSIREDMQPEIWIAQELR
RIGDEFNASYCPRRGFLDNPAVNHQIVLRLLRYIIRLIWRLQ
>gnl|bcl2dbpro|A0A8C4VJX6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL2L11 (length=172 residues).
MKQTRRDRGLARGGSWAWWRWRVGALRSAWINSPALRRGWLCPRWGGFHRHVALGRRQEKDQMAKQPSDLNSECDREGGQ
FQSTERPSQPQHLRPGAPTSIQTQYQASRWESPSIREDMQPEIWIAQELRRIGDEFNASYCPRRGFLDNPAVNHQIVLRL
LRYIIRLIWRLQ
© 1998-2022Legal notice