Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  ..*.  :   .   *                             .   .. *.: .   : :. .*:        *::
-mkrPsylkepyssrdG--------------------------rpdsvgssgpFglrsplgyrvrvsPv-------yFsl
madq peaeadrdrla rlppgegpgpavplrpgapaalpgaaldadpfhpdd aiagnaffflhrp llprsssgg af

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:.: .  * . :. :.*    .. :.                         :*   . **.*.* *              
epnrspePqsgqretrTpvqpcrkvsh------------------------yLslmnsALrVsApR--------------
daelqea mecdkaaq espiaqalqciadqfhrlhiqrhqqnrnqvwwqlf fahgl  n e n acgtslcspaqcal

       170       180  
....:....|....:....|..
    . :*:             
----srtGqr------------
pspgnes eaavcvcacvhtcl
© 1998-2022Legal notice