Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2U844_BCL2L11      MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGS
A9XRH0_BMF-01           -MDRPSYLEEDYSSLDG--------------------------LDDDVFH
                          ..*.  :   .   *                             .   

A0A3Q2U844_BCL2L11      PGPFAIRSPLFFFVRRSPLLPRSSSGYFSFEAERSPAPMSCDKATQTPSP
A9XRH0_BMF-01           SDDFGLAGNAGYRLHVPPV-------GFALDPNLQEEPQEGQREARTEVQ
                        .. *.: .   : :. .*:        *:::.: .  * . :. :.*   

A0A3Q2U844_BCL2L11      PCQAVSH------------------------YLSAMGSALRVSAPRACGT
A9XRH0_BMF-01           IARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANR----
                         .. :.                         :*   . **.*.* *    

A0A3Q2U844_BCL2L11      SLCSPAQCALPSPGSESGEAAVCVCACVHTCL
A9XRH0_BMF-01           --------------NRTGQR------------
                                      . :*:             

© 1998-2022Legal notice