Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2U844_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Gallus gallus GN=BCL2L11 (length=158 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMGSALRVSAPRACGTSLCSPAQCALPSPGSESGEAAVCVCACVHTCL
>gnl|bcl2dbpro|A9XRH0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=118 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
© 1998-2022Legal notice