Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtrtspgqkkrprwewlwegpgrrcgaslsseaghiwggchpqwyfitrsfvisvgphfpqvegkgerkggvlqvrpsgr
                                                               mgtpenplsapthvp p
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .                                     
--------------meppqcveelerd--vlqpedvepqlrpgsltsa----faqsqldcplshlqlfpl--thccgpgl
gqhprclhctpamakqksdvss-cddeggqfg-aerp-gtqksaplk-phnll-tegq------------yw--------
mnsgvmtrtrstgerg-a----s-a--srr--rls--v--vaarvsrl  gw-q--e-pnaegepdrl q  rspqaala
 ml teqpeqrrrp--s-vpriqv-esap-vll--wsalst  krrcs  d assv-vgasqatgagc a  gyls  tr
     dcnaplkqnwt  ngk grqcr c pf rrsr  as  hkkak     gkttirv prqr av    anaa  kq
       m aahaggs  e     p n      kgpa   m  di  g     cgr  qg m l         e      
                  a                                   ep  h    a                
                                                       d                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rp-s--------------------------------dkatqtlspaspsqgvmlpcgvte-----fygsag--lpqp-as
--t-qepfatrspffifvrrssllsrsssgyfsfdt----ap-----s---ps-------epqrl--ln--yr--l-v--
psatrgwaqsmfqipe epseqed            srsp--mgcdk-tpt--perqafnrttqphl--tmasmr- aqa
g wdpt                              qvtqrlsa wwtggvrrr msprqplspnvfsp fqqqks  sv
  r  a                              ap d gg  sp vdrh g   khpdgp gs ae elhehp  p 
                                       a     rh   p  e   hag     l     h  gg  e 
                                                                          e     
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vpag-------------lp-g-qp-------rpevwiar----------------eLrrig---de-fnryymrrv----
f--dgmtdvvtyyrpss--l-e--peghwqhea-iqrrqsrsappnlwaalrygvkrqcmapkprqmlhalhpqqlarlp
-vv- agaleersdhgpmansttqdpvgvem-rtqe-g-i             qrr sfrsdaln-ghvtkwkwl-skvq
nhhp             s gppsesdptmrgq-s--w-m               aq g pp   gm erqwmisergeaf
ldga             y a ne aaarfpe e pfc e                a a f     d  qgslep p a  
a                    a     aedc   m a                            a  p  f n i    
                            a a                                        d g h    
                                                                           d    
                                                                           c    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vsavyswlltyrqlnawggrrvcwqvlynlrnnqlwwprnrggygartsqsqsvslrllqymvrlvwrlqllqlhnlaln
rmytaalafgrngqgsrrvgtswrrspswtimllwplgfltnrwqvapnlpnmiiashyrdirpef prl  f       
gagl        fmkrq tlpqpmdi lf hfiisnaeeallnprssecsgrrlfvk hlqvllrg wqi          
a  i        rteqa ha  m  g a   ega i d    anepe ap mgaa   c ln     g h          
            np l      l                    g m                                  
            ee                             a                                    
                                                                                
                                                                                

       410 
....:....|.
           
-----------
aeenrngagpr
           
           
           
           
           
           
           
© 1998-2022Legal notice