Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtrtspgqkkrprwewlwegpgrrcgaslsseaghiwggchpqwyfitrsfvisvgphftqvegkgerkggvlqvrpsvr
                                      mgt enplsaptlgvgtntsspeqwearngprtrqvnsevgp
                                                mnh pdp mqg anr  akc iskaeg cq l
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             .  
------------mamePpqcss---------------------------elegdvlqpedve----------pgtqPgap
gqhprclhctpr--kqrsdvvepepveglardgprpfplsrlvpsavecdr-dgqf--aerptrrpswtywrvqlrlssl
rrgwsvpsrrhagr-s gvrtr                         sr--r----vr----akaglpqrtqsaal aq-
pl rmlgrplghperp qklfk                         kagwcepgtpavpsa          ksqg  py
       ckk  klgm hgiac                            ia segl nlqg          e g   lr
              aa aeg                                       aa                  g
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lsantfaqsqldcp---------------------------lf------gpglr--s-------tlspaspsqgvmlpcg
t-lqleq-------gdrcpqgspqsplarpaspgpflshlq--plthcc-----pt-qedkatq-----p----------
-r-----rgnpeglegerwprtmwgrtrpsrpds tatrspfsifvrrssllslsspgyfsfdtdrqns-mpcdkstqtp
whsvqwtpavtsae fppseqgdsr rdgglg   lsrnvrgptklqett ev gva mtqlvpyyd hlsgasqvetss
scdrpvpaermqia   lh  e r  p         gd pf  g h  h     de  hqdgqeas  ghg neah er 
p  palh  mfkh                                                                   
   a a   e a                                                                    
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         .      
vteepq---y--a-armpqPqsvpagmr--eq----iw--rieqe---------------------lrr--dklnay---
------rlf-gn-gyslrleaafatdlplgpeppegh-qh-aavqlpgmavyslaftynqtglrgvia-ig-efqciadq
sppcqafnhelsem--ana sqlvprs-gp--emnv-fawprga-                     --smsvrva-lrrw
rhssypagt ep  tl-ks tparm--qfitd   lyaprl---a                     wg sq q gn-pkn
   a g    ad  reegp pe egava esa    w mmeyvr                         lm g  gsfem
                 eg gd  c     g     r el c g                         fa d   p ag
                  e d               q  c                                        
                                    g                                           
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .                                                                            
-yprrhmqq-----------------------------------------------------------------------
lfhwllll-vyqgawsgprvlwlrllrlivllvwrlqprsgwgartclsnsvsarlyqdmvpefwprlllflhnlalnae
ilrqkvf-nnqrarrgsgqmiiqiqswyvrrpgrggsnpqqpnp  spgmrafvkhh qnrrrv wqi            
gwi prstltgmyspaqwswcynsimlwlpnarnaehllnea              c                       
 hg gnqseratvmeqpt gwrfl  g hn  la  eaem                                        
  e  kirvqssqi n r  ta    f dl      a                                           
     fengpnknf                                                                  
     dae i  l                                                                   
       a h  h                                                                   
         d                                                                      

         
....:....
         
---------
enrngagpr
         
         
         
         
         
         
         
         
© 1998-2022Legal notice