Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtrtspgqkkrprwewlwegpgrrcgaslsseaghiwggchpqwyfitrsfvisvgphfpqvegkgerkggvlqvrpsgr
                                                               mgtpenplsapthvp p
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------meppqcveeledd--vfqpedvepgtqpgsllsanlfaqsqldcplshlqlfpl--thccgpglrp
gqhprclhctpage-----------r-gg-l------------------------q------------yw----------
 msgteqrearkmakqksdvssqcd-e rq-graerp qlr  aptk dwlqtet-pvaqhtgrgp q  vsaqsalrpt
             prt avgr  vp r  r   krpr las  dis    agsvmvgn egrrdrl a  repam  qlg
                                                       c    ae a c    gc     kg 
                                                                             a  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tsqe------------------------------dkatqtlspaspsqgvmlpcgvteepqrl---------fygnagyr
r-sawfqtrsqipifvrrssllsrsssgyfsfdt---p-----dkst-tpsp--qafn-----gkhqrttpgh-ls---s
-r--paasmfpff                     ers-apmec----t----ks----rhrgt         -w--rma-
lkrs                               fe seq dsaqldrgrg aptgdl   p         mlrr arq
adpg                                            aal   lgd               l ap  h 
                                                                           e    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *                      .                                       :             
lplPa------------------sfPAgl------------pl--qp---hwqhraevqiar---kLrciadq-fhrlhm
qrq qssnhhggagavetrsrhsavvgdmeedegteeeeps--ge--peg-----paiw-gqsqvevqrpgrelnnayyp
mks s                  --  et             frtrstywppncw- -ey--   q gamsawglqgsnl
-gp                    ry  as              pg  rsagfllar q-w m   r a lp m hg rkk
r a                     a   p                       e    lrc         f  k  f qfi
                                                                             kd 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qqv------------------------------------------------------w----------------------
rr-gmnawgggrvcwqillflhnlalnaeenrngygartcqsqmvslrlyqymvrlv-rrqllrlhslpsqaeenrngag
--pflgrfrsrt w                   nwqsaealpnsiiapslrdirpef pll gfggnaaln         
snlqskl                          rpkp gtptmrrqvkhwtrniqsw wqn                   
mlhiq                             a    sag  afs  h qf  r  d i                   
ged                                              c                              

  
..
  
--
pr
  
  
  
  
© 1998-2020Legal notice