Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A5F5XUY6_BIK-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A337ST43_BMF-05       MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-04       MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SQ56_HRK-01       -----------------------------------MCPCPLHRGRGPPAV
A0A5F5XUY6_BIK-01       ------------------------------MNLGVDTNTQSTANWGKANC
A0A337SAW2_BAD-01       -------------MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVG
A0A337SJI7_BBC3-01      -------------------------------------MARARQEGSSPEP
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A337ST43_BMF-02       --------------------------------------------MEPPQC
A0A337ST43_BMF-05       FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-04       FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-01       --------------------------------------------MEPPQC
A0A337ST43_BMF-03       --------------------------------------------MEPPQC
                                                                          

A0A337SUX1_PMAIP1-      --------------------MPGKRTRK----------------------
A0A2I2UX96_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSL------QTEQQASMRQPQAVPA
A0A337SQ56_HRK-01       ---CACSAGRLGLRSSAAQLTAARLKAL------GDELH-----------
A0A5F5XUY6_BIK-01       KISRQENSCVVLPLGWSVLSRKGHKRKSPHGLFSKRGIRGPEGL------
A0A337SAW2_BAD-01       REQVPRRGRRLGRKRPRPLASPGDISKA--DWAGSVTVPVAQATRAGLPQ
A0A337SJI7_BBC3-01      VEGLARDGPRPFPLSR---LVPSAVSCG----LCEPGLPAAPAAPALLPA
A0A2I2UX96_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTS-----LQTEQQ------------
A0A2I2UX96_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTS-----LQTEQQGNPEGEGDRCPQ
A0A2I2UX96_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTS-----LQTEQQGNPEGEGDRCPQ
A0A337ST43_BMF-02       VEELEDD--VFQPEDVEPGTQPGSLLSA--NLFAQSQLDCPLSHLQLFPL
A0A337ST43_BMF-05       VEELEDD--VFQPEDVEPGTQPGSLLSA--NLFAQSQLDCPLSHLQLFPL
A0A337ST43_BMF-04       VEELEDD--VFQPEDVEPGTQPGSLLSA--NLFAQSQLDCPLSHLQLFPL
A0A337ST43_BMF-01       VEELEDD--VFQPEDVEPGTQPGSLLSA--NLFAQSQLDCPLSHLQLFPL
A0A337ST43_BMF-03       VEELEDD--VFQPEDVEPGTQPGSLLSA--NLFAQSQLDCPLSHLQLFPL
                                              .                           

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A5F5XUY6_BIK-01       --RNLSGAKRPSWTRT------------------------------QVAQ
A0A337SAW2_BAD-01       YWREAAGPGQGPRDRAWAQSMFQIPEFEPSEQEDS-----------SPTD
A0A337SJI7_BBC3-01      --AYLCAPTAPP----------------------------------AVTA
A0A2I2UX96_BCL2L11      ----------------------------------------------DRSP
A0A2I2UX96_BCL2L11      --GSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSP
A0A2I2UX96_BCL2L11      --GSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSP
A0A337ST43_BMF-02       --THCCGPGLRPTSQE------------------------------DKAT
A0A337ST43_BMF-05       --THCCGPGLRPTSQE------------------------------DKAT
A0A337ST43_BMF-04       --THCCGPGLRPTSQE------------------------------DKAT
A0A337ST43_BMF-01       --THCCGPGLRPTSQE------------------------------DKAT
A0A337ST43_BMF-03       --THCCGPGLRPTSQE------------------------------DKAT
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A5F5XUY6_BIK-01       QPSAPWHSVPVHREEMSHAGPLSRNVFLSTFLQEHGP-EVLDVPGMTDLV
A0A337SAW2_BAD-01       RGLGPSPTGDRPRGP-GKHQRTTPGLLGEAGHQQGQPASSNHHGGAGAVE
A0A337SJI7_BBC3-01      ALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGA------
A0A2I2UX96_BCL2L11      APMSCDKSTQTPSPPCQAFN-----HYLSAMASMRQP-QAVPAD------
A0A2I2UX96_BCL2L11      APMSCDKSTQTPSPPCQAFN-----HYLSAMASMRQP-QAVPAD------
A0A2I2UX96_BCL2L11      APMSCDKSTQTPSPPCQAFN-----HYLSAMASMRQP-QAVPAD------
A0A337ST43_BMF-02       QTLSPASPSQGVMLPCGVTEEPQRLFYAPA----KPP-SSVVAD------
A0A337ST43_BMF-05       QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP-ASFPAG------
A0A337ST43_BMF-04       QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP-ASFPAG------
A0A337ST43_BMF-01       QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP-ASFPAG------
A0A337ST43_BMF-03       QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP-ASFPAG------
                                                                          

A0A337SUX1_PMAIP1-      ----------SAQPSPARAPAEPEVECAM----------------QLRRF
A0A2I2UX96_BCL2L11      -------------------DMRPEIWIAQ----------------ELRRI
A0A337SQ56_HRK-01       ---------------------QRTMWRRR----------------ARSRR
A0A5F5XUY6_BIK-01       EYYDPGPSPNSNSPDDVAM--------------------------RLAFI
A0A337SAW2_BAD-01       TRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRM
A0A337SJI7_BBC3-01      -------LAGGPTQAAPGVRGEEEQWAREI-------------GAQLRRM
A0A2I2UX96_BCL2L11      -------M-------------RPEIWIAQ----------------ELRRI
A0A2I2UX96_BCL2L11      -------M-------------RPEIWIAQ----------------ELRRI
A0A2I2UX96_BCL2L11      -------M-------------RPEIWIAQ----------------ELRRI
A0A337ST43_BMF-02       -------SPLPTQP---GFECRREQEWGRS-------------QVRLGCP
A0A337ST43_BMF-05       -------LPLGEQPPEGHWQHRAEVQIAR----------------KLQCI
A0A337ST43_BMF-04       -------LPLGEQPPEGHWQHRAEVQIAR----------------KLQCI
A0A337ST43_BMF-01       -------LPLGEQPPEGHWQHRAEVQIAR----------------KLQCI
A0A337ST43_BMF-03       -------LPLGEQPPEGHWQHRAEVQIAR----------------KLQCI
                                                                          

A0A337SUX1_PMAIP1-      GDKLN--FRQKLMNLISKLFRSGT--------------------------
A0A2I2UX96_BCL2L11      G---DE-FNAYYPRRLARVPASYI--------------------------
A0A337SQ56_HRK-01       APAPGA-LPTYWPWLCAAAQVAALAAWLLGRRNL----------------
A0A5F5XUY6_BIK-01       G---DEMEVRWMMPRVGELPGMAVYSLAFTYNQTGLRGVLRSLMDGLANL
A0A337SAW2_BAD-01       S---DE-FQGSFKGLP----------------RPKSAGTATQMRQSPSWT
A0A337SJI7_BBC3-01      A---DD-LNALYERRR----------------QEEQQRHRPSPWRVLYNL
A0A2I2UX96_BCL2L11      G---DE-FNAYYPRRV----------------FLN---------------
A0A2I2UX96_BCL2L11      G---DE-FNAYYPRRV----------------FLN---------------
A0A2I2UX96_BCL2L11      G---DE-FNAYYPRRL----------------EQ----------------
A0A337ST43_BMF-02       P---RMGHHRKDISED----------------------------------
A0A337ST43_BMF-05       A---DQ-FHRLHMQQV----------------GMGAWGGGRVCW------
A0A337ST43_BMF-04       A---DQ-FHRLHMQQ-----------------------------------
A0A337ST43_BMF-01       A---DQ-FHRLHMQQH----------------QQNR---RRVWWQILLFL
A0A337ST43_BMF-03       A---DQ-FHRLHMQQV----------------GMGAWGGGRVCW------
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A5F5XUY6_BIK-01       RENIWIWGFLTLRNRVSPNSGRGLALSLLLLVLLLGWGLHLLQ-------
A0A337SAW2_BAD-01       RFIQSWWDRNLGRGGSAPSQ------------------------------
A0A337SJI7_BBC3-01      IMGLLPLPRARGAPEMEPN-------------------------------
A0A2I2UX96_BCL2L11      ------------NYQAAEAQPQMIILRLLRYIVRLVWRLQ----------
A0A2I2UX96_BCL2L11      ------------NYQAAEAQPQMIILRLLRYIVRLVWRLQ----------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A337ST43_BMF-05       ------------GWGARTCLSNSVSARLYQDMVPEFWPRLL---------
A0A337ST43_BMF-04       ----------------------------HQQNRRRVWWQILLFLHNLALN
A0A337ST43_BMF-01       HNLALNAEENRNGAGPRTSPGMRAFVKHC---------------------
A0A337ST43_BMF-03       ------------GWGARTCLSNSVSARLYQDMVPEFWPRLL---------
                                                                          

A0A337SUX1_PMAIP1-      -----------
A0A2I2UX96_BCL2L11      -----------
A0A337SQ56_HRK-01       -----------
A0A5F5XUY6_BIK-01       -----------
A0A337SAW2_BAD-01       -----------
A0A337SJI7_BBC3-01      -----------
A0A2I2UX96_BCL2L11      -----------
A0A2I2UX96_BCL2L11      -----------
A0A2I2UX96_BCL2L11      -----------
A0A337ST43_BMF-02       -----------
A0A337ST43_BMF-05       -----------
A0A337ST43_BMF-04       AEENRNGAGPR
A0A337ST43_BMF-01       -----------
A0A337ST43_BMF-03       -----------
                                   

© 1998-2022Legal notice