Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A337ST43_BMF-05       MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-04       MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SAW2_BAD-01       -------------MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVG
A0A337ST43_BMF-02       --------------------------------------------MEPPQC
A0A337ST43_BMF-05       FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-04       FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-03       --------------------------------------------MEPPQC
A0A337ST43_BMF-01       --------------------------------------------MEPPQC
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SQ56_HRK-01       ----------------------------------MCPCPLHRGRGPPA--
A0A337SAW2_BAD-01       REQVPRRGRRLGRKRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYW
A0A337ST43_BMF-02       VEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPL--
A0A337ST43_BMF-05       VEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPL--
A0A337ST43_BMF-04       VEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPL--
A0A337ST43_BMF-03       VEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPL--
A0A337ST43_BMF-01       VEELEDD--VFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPL--
A0A2I2UX96_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQGNPEGEGDRCPQ--
A0A2I2UX96_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTS---LQTEQQ--------------
                                                                          

A0A337SUX1_PMAIP1-      ----MPGKRTRKSA------------------------------------
A0A337SQ56_HRK-01       VCACSAGRLGLRSS------------------------------------
A0A337SAW2_BAD-01       REAAGPGQGPRDRAWAQSMFQIP---------------------EFEPSE
A0A337ST43_BMF-02       THCCGPGLRPTSQE------------------------------DKATQT
A0A337ST43_BMF-05       THCCGPGLRPTSQE------------------------------DKATQT
A0A337ST43_BMF-04       THCCGPGLRPTSQE------------------------------DKATQT
A0A337ST43_BMF-03       THCCGPGLRPTSQE------------------------------DKATQT
A0A337ST43_BMF-01       THCCGPGLRPTSQE------------------------------DKATQT
A0A2I2UX96_BCL2L11      GSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAP
A0A2I2UX96_BCL2L11      --------------------------------------------DRSPAP
                                                                          

A0A337SUX1_PMAIP1-      ----------------------------------------QPSPA-----
A0A337SQ56_HRK-01       ---AAQLTAARLKALGDELHQRT---------MWRRRARSRRAPA-----
A0A337SAW2_BAD-01       QEDSSPTDRGLGPSPTGDRPRGPGKHQRTTPGLLGEAGHQQGQPASSNHH
A0A337ST43_BMF-02       LSPASPSQGVMLPCGVTEEPQRL---------FYAPA----KPPS-----
A0A337ST43_BMF-05       LSPASPSQGVMLPCGVTEEPQRL---------FYGNAGYRLPLPA-----
A0A337ST43_BMF-04       LSPASPSQGVMLPCGVTEEPQRL---------FYGNAGYRLPLPA-----
A0A337ST43_BMF-03       LSPASPSQGVMLPCGVTEEPQRL---------FYGNAGYRLPLPA-----
A0A337ST43_BMF-01       LSPASPSQGVMLPCGVTEEPQRL---------FYGNAGYRLPLPA-----
A0A2I2UX96_BCL2L11      MSCDKSTQTPSPPCQAFN--------------HYLSAMASMRQPQ-----
A0A2I2UX96_BCL2L11      MSCDKSTQTPSPPCQAFN--------------HYLSAMASMRQPQ-----
                                                                   *      

A0A337SUX1_PMAIP1-      -------------RAPAEP---------------------------EVEC
A0A337SQ56_HRK-01       ---------------PGAL-----------------PTYWPWLCAAA---
A0A337SAW2_BAD-01       GGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRY
A0A337ST43_BMF-02       -------------SVVADS------------PLPTQP---GFECRREQEW
A0A337ST43_BMF-05       -------------SFPAGL------------PLGEQPPEGHWQHRAEVQI
A0A337ST43_BMF-04       -------------SFPAGL------------PLGEQPPEGHWQHRAEVQI
A0A337ST43_BMF-03       -------------SFPAGL------------PLGEQPPEGHWQHRAEVQI
A0A337ST43_BMF-01       -------------SFPAGL------------PLGEQPPEGHWQHRAEVQI
A0A2I2UX96_BCL2L11      -------------AVPADM-------------------------RPEIWI
A0A2I2UX96_BCL2L11      -------------AVPADM-------------------------RPEIWI
                                        .                                 

A0A337SUX1_PMAIP1-      AM---QLRRFGDKLNFRQKLMNLISKLFRSGT------------------
A0A337SQ56_HRK-01       -----QVAALAAWLLGRRNL------------------------------
A0A337SAW2_BAD-01       GR---ELRRMSDE-FQGSFKGLP---------------------------
A0A337ST43_BMF-02       GRSQVRLGCPPRMGHHRKDISED---------------------------
A0A337ST43_BMF-05       AR---KLQCIADQ-FHRLHMQQVGMGAWGGGRVCW---------------
A0A337ST43_BMF-04       AR---KLQCIADQ-FHRLHMQQ----------------------------
A0A337ST43_BMF-03       AR---KLQCIADQ-FHRLHMQQVGMGAWGGGRVCW---------------
A0A337ST43_BMF-01       AR---KLQCIADQ-FHRLHMQQHQQNR---RRVWWQILLFLHNLALNAEE
A0A2I2UX96_BCL2L11      AQ---ELRRIGDE-FNAYYPRRVFLN------------------------
A0A2I2UX96_BCL2L11      AQ---ELRRIGDE-FNAYYPRRVFLN------------------------
                              :                                           

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SAW2_BAD-01       ---RPKSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ---------
A0A337ST43_BMF-02       --------------------------------------------------
A0A337ST43_BMF-05       ---GWGARTCLSNSVSARLYQDMVPEFWPRLL------------------
A0A337ST43_BMF-04       -------------------HQQNRRRVWWQILLFLHNLALNAEENRNGAG
A0A337ST43_BMF-03       ---GWGARTCLSNSVSARLYQDMVPEFWPRLL------------------
A0A337ST43_BMF-01       NRNGAGPRTSPGMRAFVKHC------------------------------
A0A2I2UX96_BCL2L11      ---NYQAAEAQPQMIILRLLRYIVRLVWRLQ-------------------
A0A2I2UX96_BCL2L11      ---NYQAAEAQPQMIILRLLRYIVRLVWRLQ-------------------
                                                                          

A0A337SUX1_PMAIP1-      --
A0A337SQ56_HRK-01       --
A0A337SAW2_BAD-01       --
A0A337ST43_BMF-02       --
A0A337ST43_BMF-05       --
A0A337ST43_BMF-04       PR
A0A337ST43_BMF-03       --
A0A337ST43_BMF-01       --
A0A2I2UX96_BCL2L11      --
A0A2I2UX96_BCL2L11      --
                          

© 1998-2020Legal notice