Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A5F5XUY6_BIK-01       ------------------------------------------------MN
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------MGTPENPLSAPT
A0A337ST43_BMF-02       --------------------------------------------------
A0A337ST43_BMF-04       MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-05       MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
                                                                          

A0A337SUX1_PMAIP1-      ---------------------------------------------MPGKR
A0A5F5XUY6_BIK-01       LGVDTNTQSTANWGKANCKISRQENSCVVLPLGWSVLSRKGHKRKSPHGL
A0A337SQ56_HRK-01       ----------------------------------MCPCPLHRGRGPPAVC
A0A337SAW2_BAD-01       HVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGRKRPRPLASPGDI
A0A337ST43_BMF-02       --------------------------------------------MEPPQC
A0A337ST43_BMF-04       FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-05       FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-03       --------------------------------------------MEPPQC
A0A337ST43_BMF-01       --------------------------------------------MEPPQC
A0A337SJI7_BBC3-01      ------------------------------------------MARARQEG
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2UX96_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A337SUX1_PMAIP1-      TR------------------------------------------------
A0A5F5XUY6_BIK-01       FS-------------------------KRGIRGPEGLRNLSGAKRPSWTR
A0A337SQ56_HRK-01       AC------------------------------------------------
A0A337SAW2_BAD-01       SK--------------------------ADWAGSVTVPVAQATRAGLPQY
A0A337ST43_BMF-02       VE---------------------------ELEDDVFQPEDVE--------
A0A337ST43_BMF-04       VE---------------------------ELEDDVFQPEDVE--------
A0A337ST43_BMF-05       VE---------------------------ELEDDVFQPEDVE--------
A0A337ST43_BMF-03       VE---------------------------ELEDDVFQPEDVE--------
A0A337ST43_BMF-01       VE---------------------------ELEDDVFQPEDVE--------
A0A337SJI7_BBC3-01      SSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA--------
A0A2I2UX96_BCL2L11      SS-------------------------ECDREGGQLQPAERP--------
A0A2I2UX96_BCL2L11      SS-------------------------ECDREGGQLQPAERP--------
A0A2I2UX96_BCL2L11      SS-------------------------ECDREGGQLQPAERP--------
A0A2I2UX96_BCL2L11      SS-------------------------ECDREGGQLQPAERP--------
                                                                          

A0A337SUX1_PMAIP1-      --KSAQPSP-----------------------------------------
A0A5F5XUY6_BIK-01       TQVAQQPSAPWHSVPVHREEMSHA-------------------GPLSRNV
A0A337SQ56_HRK-01       --SAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARS----------
A0A337SAW2_BAD-01       WREAAGPGQGPRDRAWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRP
A0A337ST43_BMF-02       --PGTQPGSLLSANLFAQSQLDCP----------------------LSHL
A0A337ST43_BMF-04       --PGTQPGSLLSANLFAQSQLDCP----------------------LSHL
A0A337ST43_BMF-05       --PGTQPGSLLSANLFAQSQLDCP----------------------LSHL
A0A337ST43_BMF-03       --PGTQPGSLLSANLFAQSQLDCP----------------------LSHL
A0A337ST43_BMF-01       --PGTQPGSLLSANLFAQSQLDCP----------------------LSHL
A0A337SJI7_BBC3-01      --PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGP-----
A0A2I2UX96_BCL2L11      --PQLRPGAPTSLQTEQQ--------------------------------
A0A2I2UX96_BCL2L11      --PQLRPGAPTSLQTEQQ--------------------------------
A0A2I2UX96_BCL2L11      --PQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRS
A0A2I2UX96_BCL2L11      --PQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRS
                               .                                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A5F5XUY6_BIK-01       FLSTFLQEHGPEVLDVPGMTDLVEYYDPGPSPNS----------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SAW2_BAD-01       RGPGKHQRTTPGLLGEAGHQQGQPASSNHHGGAGAVETRSRHSSYPAGTE
A0A337ST43_BMF-02       QLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A337ST43_BMF-04       QLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A337ST43_BMF-05       QLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A337ST43_BMF-03       QLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A337ST43_BMF-01       QLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A337SJI7_BBC3-01      --------------------------QPSLSPAEQHLESPVPSAPG----
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      ------------------------DRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2I2UX96_BCL2L11      PFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2I2UX96_BCL2L11      PFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
                                                                          

A0A337SUX1_PMAIP1-      ----ARAPAEPEVECAMQ--------------------------------
A0A5F5XUY6_BIK-01       -------NSPDDVAMRLAFIGDEMEVRWMMPRVGELPGMAVYSLAFTYNQ
A0A337SQ56_HRK-01       ----RRAPAPGALPT-----------YWPWLCAAA---------------
A0A337SAW2_BAD-01       EDEGTEEEEPSPFRGRSR--SAPPNLWAALRYGRE---------------
A0A337ST43_BMF-02       APA----KPPSSVVADSPLPTQP---GFECRREQE---------------
A0A337ST43_BMF-04       GNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQ---------------
A0A337ST43_BMF-05       GNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQ---------------
A0A337ST43_BMF-03       GNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQ---------------
A0A337ST43_BMF-01       GNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQ---------------
A0A337SJI7_BBC3-01      ----ALAGGPTQAAPGVRGEEE----QWAREIGAQ---------------
A0A2I2UX96_BCL2L11      ----ASMRQPQAVPADMR--PE----IW---IAQE---------------
A0A2I2UX96_BCL2L11      LSAMASMRQPQAVPADMR--PE----IW---IAQE---------------
A0A2I2UX96_BCL2L11      LSAMASMRQPQAVPADMR--PE----IW---IAQE---------------
A0A2I2UX96_BCL2L11      LSAMASMRQPQAVPADMR--PE----IW---IAQE---------------
                                                                          

A0A337SUX1_PMAIP1-      ------LRRFGDKLN------FRQKLMNLISKLFRSGT------------
A0A5F5XUY6_BIK-01       TGLRGVLRSLMDGLANLRENIWIWGFLTLRNRVSPNSGRGLALSLLLLVL
A0A337SQ56_HRK-01       ------------QVAALAAWLLGRRNL-----------------------
A0A337SAW2_BAD-01       ------LRRMSDEFQGSFKG-LPRPKSAGTATQMRQSPSWTRFIQSWWDR
A0A337ST43_BMF-02       ------WGRSQVRLGCPPRMGHHRKDISED--------------------
A0A337ST43_BMF-04       ------IAR---KLQCIADQ-FHRLHMQQ---------------------
A0A337ST43_BMF-05       ------IAR---KLQCIADQ-FHRLHMQQVGMGAWGGGRVCW--------
A0A337ST43_BMF-03       ------IAR---KLQCIADQ-FHRLHMQQVGMGAWGGGRVCW--------
A0A337ST43_BMF-01       ------IAR---KLQCIADQ-FHRLHMQQHQQNR---RRVWWQILLFLHN
A0A337SJI7_BBC3-01      ------LRRMADDLNAL----YERRRQEEQQRHRPSPWRVLYNLIMGLLP
A0A2I2UX96_BCL2L11      ------LRRIGDEFNAY----YPRRLARVPASYI----------------
A0A2I2UX96_BCL2L11      ------LRRIGDEFNAY----YPRRVFLNNYQAAEAQPQMIILRLLRYIV
A0A2I2UX96_BCL2L11      ------LRRIGDEFNAY----YPRRLEQ----------------------
A0A2I2UX96_BCL2L11      ------LRRIGDEFNAY----YPRRVFLNNYQAAEAQPQMIILRLLRYIV
                                     .         .                          

A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A5F5XUY6_BIK-01       LLGWGLHLLQ----------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
A0A337SAW2_BAD-01       NLGRGGSAPSQ---------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A337ST43_BMF-04       --------------------------HQQNRRRVWWQILLFLHNLALNAE
A0A337ST43_BMF-05       ----------GWGARTCLSNSVSARLYQDMVPEFWPRLL-----------
A0A337ST43_BMF-03       ----------GWGARTCLSNSVSARLYQDMVPEFWPRLL-----------
A0A337ST43_BMF-01       LALNAEENRNGAGPRTSPGMRAFVKHC-----------------------
A0A337SJI7_BBC3-01      LPRARGAPEMEPN-------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      RLVWRLQ-------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      RLVWRLQ-------------------------------------------
                                                                          

A0A337SUX1_PMAIP1-      ---------
A0A5F5XUY6_BIK-01       ---------
A0A337SQ56_HRK-01       ---------
A0A337SAW2_BAD-01       ---------
A0A337ST43_BMF-02       ---------
A0A337ST43_BMF-04       ENRNGAGPR
A0A337ST43_BMF-05       ---------
A0A337ST43_BMF-03       ---------
A0A337ST43_BMF-01       ---------
A0A337SJI7_BBC3-01      ---------
A0A2I2UX96_BCL2L11      ---------
A0A2I2UX96_BCL2L11      ---------
A0A2I2UX96_BCL2L11      ---------
A0A2I2UX96_BCL2L11      ---------
                                 

© 1998-2022Legal notice