Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A337SAW2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Felis catus GN=BAD (length=273 residues).
MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGRKRPRPLASPGDISKADWAGSVTVPVAQATR
AGLPQYWREAAGPGQGPRDRAWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTTPGLLGEAGHQQGQP
ASSNHHGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKGLPRPKSA
GTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A337SQ56_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Felis catus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A337ST43_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=287 residues).
MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISVGPHFPQVEGKGERKGGVLQVRPSGR
GQHPRCLHCTPAGEMEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQE
DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHR
LHMQQVGMGAWGGGRVCWGWGARTCLSNSVSARLYQDMVPEFWPRLL
>gnl|bcl2dbpro|A0A337ST43_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=193 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQVGMGAWGGG
RVCWGWGARTCLSNSVSARLYQDMVPEFWPRLL
>gnl|bcl2dbpro|A0A337ST43_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=149 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAKPPSSVVADSPLPTQPGFECRREQEWGRSQVRLGCPPRMGHHRKDISED
>gnl|bcl2dbpro|A0A337ST43_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=196 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPRTSPGMRAFVKHC
>gnl|bcl2dbpro|A0A337ST43_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=278 residues).
MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISVGPHFPQVEGKGERKGGVLQVRPSGR
GQHPRCLHCTPAGEMEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQE
DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHR
LHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A337SUX1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Felis catus GN=PMAIP1 (length=54 residues).
MPGKRTRKSAQPSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
© 1998-2020Legal notice