Dataset for protein Bmf of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtrtspgqkkrprwewlwegpgrrcgaslsseaghiwggchpqwyfitrsfvisvgphfpqvegkgerkggvlqvrpsgr
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              ******************************************************************
--------------MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQE
gqhprclhctpage                                                                  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************************. *      *:*. *. **  **    :: * * : .*   .* * .  
DKATQTLSPASPSQGVMLPCGVTEEPQRLFYgnAgyrlplPaSfpAglPLgeQPpeghwqhRaEvqiaR---kLqCiadq
                               ap ----kp s vv ds  pt  ---gfec r qewg sqvr g pprm
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .**  :.:                                                                       
-fHRlhmqqv--------rv-w------------------g-g-rt----------yq------w---l-----------
gh  kdise-gmgawggg--c-qillflhnlalnaeenrn-w-a--clsnsvsarl--dmvpef-prl-lflhnlalnae
         hqqnr   r  w                    a p  spgmrafvkhh qnrrrv wqi            
         d                                              c                       

         
....:....
         
---------
enrngagpr
         
         
© 1998-2020Legal notice