Dataset for protein Bmf of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A337ST43_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=196 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPRTSPGMRAFVKHC
>gnl|bcl2dbpro|A0A337ST43_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=193 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQVGMGAWGGG
RVCWGWGARTCLSNSVSARLYQDMVPEFWPRLL
>gnl|bcl2dbpro|A0A337ST43_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=149 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAKPPSSVVADSPLPTQPGFECRREQEWGRSQVRLGCPPRMGHHRKDISED
>gnl|bcl2dbpro|A0A337ST43_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=278 residues).
MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISVGPHFPQVEGKGERKGGVLQVRPSGR
GQHPRCLHCTPAGEMEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQE
DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHR
LHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A337ST43_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=287 residues).
MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISVGPHFPQVEGKGERKGGVLQVRPSGR
GQHPRCLHCTPAGEMEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQE
DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHR
LHMQQVGMGAWGGGRVCWGWGARTCLSNSVSARLYQDMVPEFWPRLL
© 1998-2020Legal notice