Dataset for protein Bmf of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-05      MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
                                                                         

A0A337ST43_BMF-02      --------------------------------------------MEPPQC
A0A337ST43_BMF-04      FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-05      FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-01      --------------------------------------------MEPPQC
A0A337ST43_BMF-03      --------------------------------------------MEPPQC
                                                                   ******

A0A337ST43_BMF-02      VEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCC
A0A337ST43_BMF-04      VEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCC
A0A337ST43_BMF-05      VEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCC
A0A337ST43_BMF-01      VEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCC
A0A337ST43_BMF-03      VEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCC
                       **************************************************

A0A337ST43_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA----KP
A0A337ST43_BMF-04      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A337ST43_BMF-05      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A337ST43_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A337ST43_BMF-03      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
                       *****************************************. *      

A0A337ST43_BMF-02      PSSVVADSPLPTQP---GFECRREQEWGRSQVRLGCPPRMGHHRKDISED
A0A337ST43_BMF-04      PASFPAGLPLGEQPPEGHWQHRAEVQIAR---KLQCIADQ-FHRLHMQQ-
A0A337ST43_BMF-05      PASFPAGLPLGEQPPEGHWQHRAEVQIAR---KLQCIADQ-FHRLHMQQV
A0A337ST43_BMF-01      PASFPAGLPLGEQPPEGHWQHRAEVQIAR---KLQCIADQ-FHRLHMQQH
A0A337ST43_BMF-03      PASFPAGLPLGEQPPEGHWQHRAEVQIAR---KLQCIADQ-FHRLHMQQV
                       *:*. *. **  **    :: * * : .*   .* * .   .**  :.: 

A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      ----------------------------------------------HQQN
A0A337ST43_BMF-05      GMGAWGGGRVCW------------------GWGARTCLSNSVSARLYQDM
A0A337ST43_BMF-01      QQNR---RRVWWQILLFLHNLALNAEENRNGAGPRTSPGMRAFVKHC---
A0A337ST43_BMF-03      GMGAWGGGRVCW------------------GWGARTCLSNSVSARLYQDM
                                                                         

A0A337ST43_BMF-02      -----------------------------
A0A337ST43_BMF-04      RRRVWWQILLFLHNLALNAEENRNGAGPR
A0A337ST43_BMF-05      VPEFWPRLL--------------------
A0A337ST43_BMF-01      -----------------------------
A0A337ST43_BMF-03      VPEFWPRLL--------------------
                                                    

© 1998-2020Legal notice