Dataset for protein classical BH3-containing proteins of organism Erpetoichthys calabaricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                       .* * ..:* :            . .      *  :     
mmarppsdlnsesgagdggplq-tqlag-plakmfplshp g qege ihdgessryenslqsslrqsrmp rikmsfvc
 v evevt            imssvetdav-------m   e      f  adldgr hria gfkhca m  ah fdia
                     d fi f  lpl sri                                            

        90       100       110       120       130       140       150       160
 *:  ..  . *     .  ..  .                                                       
q ipgfkesqq sqgtsnflsgssns--ymtdkvtqt--yssygtrhhrqwlpqhy-vyrgh-tpqgsrghsqerrssmp
g   e   fda eaemddeefr m  s   gfqee  llfqaiaaaqlhfaaef hdqdg meeamaeeeaa      

       170       180       190       200       210       220       230  
  : .    ..:*.*:.*:*   : :                      *        :              
eemspaeqvark q ms e hnlhgemvarkrak-a-rakgmnpqpsr rmavtllal-fdkdagsnssk-r
 a r  ami         d gid f f   lypgivw-ra tscgr-g vvvfvwrm d------permd n
                              aq   glqn  aea q   lihcraql  ilt wr       
© 1998-2023Legal notice