Dataset for protein classical BH3-containing proteins of organism Erpetoichthys calabaricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4REW7_BCL2L11      -MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQ
A0A8C4REW7_BCL2L11      -MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQ
A0A8C4SHZ6_BMF-02       MVAEVEVTLN----------IDPFVLFDRLPLRSRIRMDPEEDIEDDVFH
A0A8C4SHZ6_BMF-01       -------------------------------------MDPEEDIEDDVFH
A0A8C4SET9_BAD-01       ------------------------------MAKMFSLSDSESDISDDVIQ
A0A8C4SET9_BAD-02       ---------------------MSSILTDAVMAKMFSLSDSESDISDDVIQ
                                                               .* * ..:* :

A0A8C4REW7_BCL2L11      PA-----PNSLQGGL---AMPPSPHPY--ASRFPLFSYFSRSSSGYYSFE
A0A8C4REW7_BCL2L11      PA-----PNSLQGGL---AMPPSPHPY--ASRFPLFSYFSRSSSGYYSFE
A0A8C4SHZ6_BMF-02       PPELDRYPHTISGTFRHCSTSPRANPFFICQRFREVKYVDQSTQTTSNHV
A0A8C4SHZ6_BMF-01       PPELDRYPHTISGTFRHCSTSPRANPFFICQRFREVKYVDQSTQTTSNHV
A0A8C4SET9_BAD-01       DGDSSGREVRNASSVKQSRTMPSIKMSDVEGRIRGVSESQASEAEMDDEL
A0A8C4SET9_BAD-02       DGDSSGREVRNASSVKQSRTMPSIKMSDVEGRIRGVSESQASEAEMDDEL
                                    . .      *  :      *:  ..  . *     .  

A0A8C4REW7_BCL2L11      SGSVSSLPSMTDKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSG
A0A8C4REW7_BCL2L11      SGSVSSLPSMTDKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSG
A0A8C4SHZ6_BMF-02       PSYSSMLPY---GVQEEPSYLFYGTAAHRLHFPAHFEVDRDGDTEEGMAE
A0A8C4SHZ6_BMF-01       PSYSSMLPY---GVQEEPSYLFYGTAAHRLHFPAHFEVDRDGDTEEGMAE
A0A8C4SET9_BAD-01       TSFRN-------------------------------------------RS
A0A8C4SET9_BAD-02       TSFRN-------------------------------------------RS
                        ..  .                                             

A0A8C4REW7_BCL2L11      PTRARRSSMPEEMRPEEMVAQELRRIGDDFNNLYFQRVARAYPGSVWRRA
A0A8C4REW7_BCL2L11      PTRARRSSMPEEMRPEEMVAQELRRIGDDFNNLYFQR------GIGGRNN
A0A8C4SHZ6_BMF-02       EEQE------PGLSAEAQIGQKLQRIGDQFHRDYTQM---------LQQN
A0A8C4SHZ6_BMF-01       EEQE------PGLSAEAQIGQKLQRIGDQFHRDYTQM---LQ------QN
A0A8C4SET9_BAD-01       HSAP------PALWAARRYGRELRRMSDEFGISHGEF---KRAKSAGTAK
A0A8C4SET9_BAD-02       HSAP------PALWAARRYGRELRRMSDEFGISHGEF---KRAKSAGTAK
                                    : .    ..:*.*:.*:*   : :              

A0A8C4REW7_BCL2L11      GTSCGQ-GWLVHCRAQML--------------
A0A8C4REW7_BCL2L11      GAEASRLRWVIVFVWRLFDILTRWR-------
A0A8C4SHZ6_BMF-02       QRNPQPLWWRMAVTLLAFLFDRDAGPNRMDAR
A0A8C4SHZ6_BMF-01       QRNPQPLWWRMAVTLLAFLFDRDAGPNRMDAR
A0A8C4SET9_BAD-01       QMTTSTSWW-------TFLWSKRQQSESSKAN
A0A8C4SET9_BAD-02       QMTTSTSWW-------TFLWSKRQQSESSKAN
                                *        :              

© 1998-2022Legal notice