Dataset for protein classical BH3-containing proteins of organism Erpetoichthys calabaricus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C4REW7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BCL2L11 (length=206 residues).
MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQPAPNSLQGGLAMPPSPHPYASRFPLFSYFSR
SSSGYYSFESGSVSSLPSMTDKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSGPTRARRSSMPEEMRPEEMVAQ
ELRRIGDDFNNLYFQRVARAYPGSVWRRAGTSCGQGWLVHCRAQML
>gnl|bcl2dbpro|A0A8C4REW7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BCL2L11 (length=208 residues).
MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQPAPNSLQGGLAMPPSPHPYASRFPLFSYFSR
SSSGYYSFESGSVSSLPSMTDKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSGPTRARRSSMPEEMRPEEMVAQ
ELRRIGDDFNNLYFQRGIGGRNNGAEASRLRWVIVFVWRLFDILTRWR
>gnl|bcl2dbpro|A0A8C4SET9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BAD (length=143 residues).
MAKMFSLSDSESDISDDVIQDGDSSGREVRNASSVKQSRTMPSIKMSDVEGRIRGVSESQASEAEMDDELTSFRNRSHSA
PPALWAARRYGRELRRMSDEFGISHGEFKRAKSAGTAKQMTTSTSWWTFLWSKRQQSESSKAN
>gnl|bcl2dbpro|A0A8C4SET9_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BAD (length=152 residues).
MSSILTDAVMAKMFSLSDSESDISDDVIQDGDSSGREVRNASSVKQSRTMPSIKMSDVEGRIRGVSESQASEAEMDDELT
SFRNRSHSAPPALWAARRYGRELRRMSDEFGISHGEFKRAKSAGTAKQMTTSTSWWTFLWSKRQQSESSKAN
>gnl|bcl2dbpro|A0A8C4SHZ6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BMF (length=204 residues).
MVAEVEVTLNIDPFVLFDRLPLRSRIRMDPEEDIEDDVFHPPELDRYPHTISGTFRHCSTSPRANPFFICQRFREVKYVD
QSTQTTSNHVPSYSSMLPYGVQEEPSYLFYGTAAHRLHFPAHFEVDRDGDTEEGMAEEEQEPGLSAEAQIGQKLQRIGDQ
FHRDYTQMLQQNQRNPQPLWWRMAVTLLAFLFDRDAGPNRMDAR
>gnl|bcl2dbpro|A0A8C4SHZ6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BMF (length=177 residues).
MDPEEDIEDDVFHPPELDRYPHTISGTFRHCSTSPRANPFFICQRFREVKYVDQSTQTTSNHVPSYSSMLPYGVQEEPSY
LFYGTAAHRLHFPAHFEVDRDGDTEEGMAEEEQEPGLSAEAQIGQKLQRIGDQFHRDYTQMLQQNQRNPQPLWWRMAVTL
LAFLFDRDAGPNRMDAR
© 1998-2022Legal notice