Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vrvsfpaaragppqavgaarspwvqpqtrgpgtrprssrscdvlapsslspglslprllpltnqgapgrrptsqgrrgtr
   mag  amelcrcreesfgdvgpqeegegvgqaaplllaalfpglqadcppchlacfsgdhccgl lvkaraedkaaq
          caa rpa ledalfcsad plrsehg gtpysq   agrg   rr  p  aqpp       kavwssvle
          rkr  h   krqtwd ns    e     s gg                                 l pg 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------g------mae-p----------rvssecrrpggq---lqpper-pqlrpgaptalqle-igd----r---
arsqrspvsq-rplpaqlhkq-srlfygnagydspeaadveaqlpltessad-p--h-aersis--i-q-a-qmnr-wmq
tmtrvgemgrdvmkkdgvtlesq         vp-rplsfsemtetgwglsqsqws-t-rvqvprr-rrq-relhvlhvl
elpparafrkslicdcf-p-r r         pltl-dekl ppspara rvpsnrvqwa-ekgmkdqfmqstfgsqass
  faip  p qsfaarhr-rg p         m a-rpggg  sq qdw gsggeesdn-dtc il achdnsreqpyrr
        e pcl  leqsd            a  pkhae   r   ar    da palq la gg gla hpqwpmsec
        a m     cpg                 c  c   g         a  e h     a   e   mpqfgrc 
          a      e                     a                d               kgae da 
                                                                        d  a    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------l-----------------
phqqnlprvawysllftynqtgedegmegelrgvfrsrsdgltplrenirrwsfltrrdsvs-qlngqespsgmgsrcpq
qriaernglwvqtraslhpegt        sp p atfmrsapnnlwfv fygres ssrgyfrfhqddnrnpaspsr g
sqhspagp etra h s             e     g       ffiaa  s l l  m de aiedlal gckcaql  
r ggg  a  pp                                                   tvstrra rve dpf  
   e                                                           s df g  a   c    
                                                                 a              
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------dkstqtpsppc-----qaf----
gsplrplpgspgspgpggtvspgfifvrrssllsrsssgyfsfdtdrspapmscgrpepavrpavw-slagch--lrrig
 pggg h ap a   gfaarg f                        g  aadg   p--r-g--gwl     at-    
                                                         gtw-w-vq-vg     vsy    
                                                         -srssssptr-     sps    
                                                         rrqqhrrlskr     plh    
                                                         qqnpemeeria     hga    
                                                          lgmac c h      ee     
                                                          ae  a   e             
                                                           d      a             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
nhylsamasmrqsqavpad-------------w-----------------------------------------------
qlwtallprlls-cg----mrnpsgpgdlpev-iaqelrrigdefnasyprrvvlnhhqaaeahpqmiilrllryiirlv
dppnrsiqpv-pra-tlyptvgl     ksqlgllyrpgdv slpgrtllpwlayasaggsfctm               
--lmnphvqftaq-vcftess       gqprfwdtn   g  agsqlg  pdeq                         
wsfhgeyll-s-lvtwnqtrq        gl  scr          p                                 
tki ccfgkrqrhsspemhpp        ac  a                                              
agc   e eppheplfclgnn                                                           
 e    a caigch a g gl                                                           
          feag   f f                                                            
          a  f                                                                  

    
....
    
----
rrlq
    
    
    
    
    
    
    
    
© 1998-2022Legal notice