Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vrvmfpaaamgppravgaargdvgqpeergpgtrprssrscdvlapsslspglslprllpltnqgapgrrptsqgrrgtr
   sag  raeaaqcreeledalfcsadgegvgqaaplllaalfpglqadcppchlacfsgdhccgl lvkaraedkaaq
          rlr rpa sksqwwpqqt plrsehg gtpysq   agrg   rr  p  aqpp       kavwssvle
          ckc  h   frptvd ns    e     s gg                                 l pg 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------pr---------dvssecdreggq---lqpaerppq-lrpgaptalqleqi---------
arsrrspvsrgrmlpdqvtemaqqlfygnapsrpprpasfpaqpplteslpdsswdqh-a-rsvs--i---gdqmhvrwm
tltpare gqdvikmcgmpkr-kr  ldafgyelalalrcspplspgwgttswqasp-t-r-qiprr-qfqanefgrlhs
empqvga rkalpmksclapqv-v      spms---hlvvlmte atpssqgvsr vdnev-slmkdach hpqeqpdr
   a        fadrfpllesss      lhgrtpr ekq  r   sefrppene tahqqtk iparra  klnfga 
              cp ihhvg g      eaad ek aeg  m   ra g ld   s gpdlc gl gl    g e   
              af  g fe d         a         g   a     a   p  a  a  g  e          
               a                                         d                      
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------l----qrsp-pmgp---
qphqqnlprvawysllftynqtgedegmegelrgvfrsrsdgltplrenirrwsfltrrdsvs-qlngdenrsgasarcp
lqqiaernglwvqtraslhpegt        sp p atfmrsapnnlwfv fygres ssrgyfrfhql---n----sr 
ss hspagp etra h s             e     g       ffiaa  s l l  m de aied-dtmgcscsql 
c  ggg  a  pp                                                   tvstram avracpf 
                                                                s dfasl wsqrv   
                                                                  a  ga vrk d   
                                                                        r e     
                                                                        q       
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------dkstqtpsppc-----qaf---
qgsplrplpgspgspgpggtvspgfifvrrssllsrsssgyfsfdtdrspapmscgrpgpavrgavwaslagch--lrri
g pggg h ap a   gfaarg f                        g  aadg   pa---p--g-l     pt- ge
                                                          e-wsw-vt-vg     agy   
                                                          -trrsssqtra     ssv   
                                                          rsnqgmrpsk-     hps   
                                                          qrlpecelri      eeh   
                                                           lgmaa eqh        a   
                                                            ee   c e            
                                                            d                   
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-nhylsamasmrqsqavpad-------------w----------------------------------------------
gqpwtrsiqrlls-cg----mrgpsgpgdlpev-iaqelrrigdepnasyprrvvlnhhqaaeahpqmiilrllryiirl
edlpnalhppv-rr--tllptl       kslrrlqyrqgdvrssfgrvlypwlaylsplpsgrtmpemepn        
 --lhneygqftpqvvcfytsv       gyqlgwltnpq h plgwqtglnpimqalaggrfcaa              
 wsfacplvk-salstwntnrs        qp fsdr    g  a spl   ldeg                        
 tqc  cflerq-hpsfdqhnq        nc  rce                                           
 ek    e cqphemldcgggp        g   a                                             
 ag    a aaiech a fef         a                                                 
  e        f ag     a                                                           
           a  f                                                                 
              a                                                                 

     
....:
     
-----
vrrlq
     
     
     
     
     
     
     
     
     
© 1998-2022Legal notice