Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vrvmfpaaamgppravgaargdvgqpeergpgtrprssrscdvlapsslspglslprllpltnqgapgrrptsqgrrgtr
mcpsplhmraqasqcreeledalfcsadgegvgqaaplllaalfpglqadcppchlacfsgdhccgl lvkaraedkaaq
   cag rgkeladrpa sksqwwpqqt plrsehg gtpysq   agrg   rr  p  aqpp       kavwssvle
         rrkra h   frptvd ns    e     s gg                                 l pg 
          c c                                                                   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  .:                            
-------------------e------------rssecdrrpgglplaeqppq----lrpgaptal-l--igd----r---
arsqrspvsrgrmlprqla-qpsrlfygnagyvvpsaasegaqtqptlssaerqpqh-aersvs-q-eq---qmer-wms
tmtrvgemgqdvikkdgvtke q         dp-rplevepmq--gwrvsdgpws-t-rvqiprriqfqarpfhvlhvq
elpparafrkslfadcfmplr r         mltlecdfa rpst-swa  ssnrvdn--tslmkdachqsergqqasl
  faip  e q p vavshg            a-r-rhcss psefsrg   pd ptalqqlk il rradntqwspsrc
        a a   a cpsd             aapk  ql  ag rpa       s hpdec gg gl  hspqpmre 
                 e                 a   k       d        p ga  a     e   mlnfhlc 
                                       g                d               kgaegda 
                                                                         a      
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------l-------p---------
phqsnlgrvawysllftynqtgedegmegelrgpfrsrsdgltplrenirrwsfltrrmsvs-qlngqrs-sgmgsrcpq
qviqerpglwvqtraslhpegt        ep vtqtfmrvrpnnlwwa fygrql sdrdyfrfhqdenrnpaspsr g
sqpappna etra h s             sg   agapgsageffqfv es les  sage aiedldr gckcaql  
  hgga p  pp                        a       eeia   i a       d tvsyral rve dpf  
  g a                                                          saltega q   c    
                                                               n df    a        
                                                                 a              
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------dkstqtpsppc-----qal----
gsplrplpgspgspgpggtvspgfifvrrssllsrsssgyfsfdtdrspapmscgrpepavrprvw-slagch--frrig
 pggg h ap a   gfaarg f                        g  aadg   p--q-gapsvl     at-    
                                                         gtw-w---grg     svy    
                                                         -srsssvq-k-     rss    
                                                         rrqremsltiw     pph    
                                                         qlnpaheerha     hga    
                                                          egm c c e      ee     
                                                          ae  a   a             
                                                           d                    
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
nhylsamaslrqsqavpad-------------w-----------------------------------------------
qpltaslqpmps-cg----mrnpsgpgdlpev-iaqelrrigdefnasyprrvvlnhhqaaeahpqmiilrllryiirlv
dlwnrliprvlrq--tlyptpgl     ksqlgllyrpgdv slpgrtllpwlayasaggsfctm               
--pinphlqf-plvvcfttsv       gqprfwdtn   g  agsqlg  pdeq                         
ysfhmgyvk-tahstanqmrs        nl  scr          p                                 
wnc cefgers-grswclhnq        gc  a                                              
tk   ce caqheplf gggl        a                                                  
ag    a   iech   fef                                                            
 e        f ag   e e                                                            
          a  f                                                                  
             a                                                                  

    
....
    
----
rrlq
    
    
    
    
    
    
    
    
    
© 1998-2020Legal notice