Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A3Q2IBL3_HRK-01       MCPCPLHRGRGPPA------------------------------------
A0A3Q2GRS5_BCL2L11      -------MAKQPSD------------------------------------
A0A3Q2GRS5_BCL2L11      -------MAKQPSD------------------------------------
A0A3Q2GWE8_BBC3-01      VRVSAGAARACLCQAPGASFSPWVPQQTRGPRERHGPSTPGGQLPGAGRG
A0A3Q2GRS5_BCL2L11      ---MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSAS
A0A3Q2GRS5_BCL2L11      ---MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSAS
A0A3Q2LHE3_BIK-02       ---------MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSV-------
A0A3Q2HR24_BMF-01       ---------MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLD
A0A3Q2HR24_BMF-02       ---------MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLD
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GWE8_BBC3-01      PGPRRPAPLPAQPPGALGRV-----LRPLRARPARRA-RRARPAARCLPL
A0A3Q2GRS5_BCL2L11      PGLCLPRCLSGDNQGAPGRRKARAGRRGARARTRRSE-GKGRIKKDQMAK
A0A3Q2GRS5_BCL2L11      PGLCLPRCLSGDNQGAPGRRKARAGRRGARARTRRSE-GKGRIKKDQMAK
A0A3Q2LHE3_BIK-02       --------------------PKAVWSSVGEEMSQVGPVSRDLFLDAFLHE
A0A3Q2HR24_BMF-01       CPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASP-SQGVMLPCGVTE
A0A3Q2HR24_BMF-02       CPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASP-SQGVMLPCGVTE
A0A3Q2GWE8_BBC3-02      --------------------------------------------VRVSAG
A0A3Q2LHE3_BIK-01       -------------------------------MSQVGPVSRDLFLDAFLHE
A0A3Q2GRS5_BCL2L11      -------------------------------------MAKQ------PSD
F7DN67_BAD-01           -------------------------------MFQIPEFEQS------EPE
                                                                          

A0A3Q2I0H2_PMAIP1-      ------------MPTRKARKSGQPSPTRAPAE------LEAECAIQIRRI
A0A3Q2IBL3_HRK-01       ------------V---CACSAGRLGLRSSAAQ----LTAARLKALGDELH
A0A3Q2GRS5_BCL2L11      ------------VSSECDREGGQLQPAERPPQ----LRPGAPTSLQIEQQ
A0A3Q2GRS5_BCL2L11      ------------VSSECDREGGQLQPAERPPQ----LRPGAPTSLQIEQQ
A0A3Q2GWE8_BBC3-01      RPR---------RPARRHRRPGGPPLAWGPPQPSPSPAPRRSTA------
A0A3Q2GRS5_BCL2L11      QPS---------DVSSECDREGGQ---LQPAERPPQLRPGAPTS------
A0A3Q2GRS5_BCL2L11      QPS---------DVSSECDREGGQ---LQPAERPPQLRPGAPTS------
A0A3Q2LHE3_BIK-02       ------------RSPEALEVPGMTELTESSPDSDNRD----SVAMRLAFI
A0A3Q2HR24_BMF-01       EPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCI
A0A3Q2HR24_BMF-02       EPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCI
A0A3Q2GWE8_BBC3-02      ------------AARACLCQAPGASFSPWVPQ---QTRGPQPSLL-----
A0A3Q2LHE3_BIK-01       ------------RSPEALEVPGMTELTESSPD----SDNRDSVAMRLAFI
A0A3Q2GRS5_BCL2L11      ------------VSSECDREGGQLQPAERPPQ----LRPGAPTSLQIEQQ
F7DN67_BAD-01           ------------DSSPADRGLGPSPTGDWPSD---PVRHQRTAPGLLGEA
                                                      .:                  

A0A3Q2I0H2_PMAIP1-      GDKLNFR-------------------------------------------
A0A3Q2IBL3_HRK-01       QRTMWRRRA-----------------------------------------
A0A3Q2GRS5_BCL2L11      DRSPAPMSC-----------------------------------------
A0A3Q2GRS5_BCL2L11      ASMRQSQAV-----------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-02       GDEMEVRWMLPHIAELPGVAVYSLAFTYNQTG--------LRGVFRSFMD
A0A3Q2HR24_BMF-01       ADQFHRLHMQQHQQNRNRVWWQTLLFLHN---------------------
A0A3Q2HR24_BMF-02       ADQFHRLHMQQHQQNRNRVWWQTLLFLHN---------------------
A0A3Q2GWE8_BBC3-02      --PAEQHLESPVPSAPGAL---------------------EGGPTQAAPG
A0A3Q2LHE3_BIK-01       GDEMEVRWMLPHIAELPGVAVYSLAFTYNQTG--------LRGVFRSFMD
A0A3Q2GRS5_BCL2L11      GNPGGEGDRCPQGSPLGPLAPPA-----------------SPGPFATRS-
F7DN67_BAD-01           GHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEDEGMEGEEPGPFRGRSR
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GWE8_BBC3-01      ----------------------LTLAGRAAPGVAGAQRPGGPGGRPHPGS
A0A3Q2GRS5_BCL2L11      ----------------------LQIEQQ----------------------
A0A3Q2GRS5_BCL2L11      ----------------------LQIEQQGNPGGEGDRCPQGSPLGPL-AP
A0A3Q2LHE3_BIK-02       GLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCSPL------------
A0A3Q2HR24_BMF-01       ----------------------LALNGDENRNGAGPSF------------
A0A3Q2HR24_BMF-02       ----------------------LALNGDENRNGAGPRC------------
A0A3Q2GWE8_BBC3-02      VRGEEEQWAREIGAQLRRMADDLNALYERRRQ------------------
A0A3Q2LHE3_BIK-01       GLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCS--------------
A0A3Q2GRS5_BCL2L11      ---PFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSC--------------
F7DN67_BAD-01           SAPPNLWAARRYGRELRRMSDEFQVSFQALPRPKSA--------------
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A3Q2IBL3_HRK-01       -----------------------------------------------RSR
A0A3Q2GRS5_BCL2L11      -----------------------------------------------DKS
A0A3Q2GRS5_BCL2L11      -----------------------------------------------PAD
A0A3Q2GWE8_BBC3-01      PGSPGGGGAVGPG----------------------DRGPAAADGGRPERA
A0A3Q2GRS5_BCL2L11      -----------------------------------DRSPAPMSC---DKS
A0A3Q2GRS5_BCL2L11      PASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSC---DKS
A0A3Q2LHE3_BIK-02       -----------------------------------------------EPW
A0A3Q2HR24_BMF-01       -----------------------------------------------QPG
A0A3Q2HR24_BMF-02       -----------------------------------------------GKN
A0A3Q2GWE8_BBC3-02      -----------------------------------------------EEQ
A0A3Q2LHE3_BIK-01       -----------------------------------------------PLE
A0A3Q2GRS5_BCL2L11      -----------------------------------------------DKS
F7DN67_BAD-01           -----------------------------------------------GTA
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------QKLLNLIAKLFRSGT---------------
A0A3Q2IBL3_HRK-01       RAPAPGAL-----PTY----WPWLCAAAQVAALAAWLLGRRNL-------
A0A3Q2GRS5_BCL2L11      TQTPSPPC-----QAF----NHYLSAMVRAIEEVVV--------------
A0A3Q2GRS5_BCL2L11      MRPEVWIA-----QELRRIGDEFNASYPRRLAQCLAFYT-----------
A0A3Q2GWE8_BBC3-01      VRAAETRG-----AAA----TPPLALEGPVQSHHGTPAPTQGPSGPGDGA
A0A3Q2GRS5_BCL2L11      TQTPSPPC-----QAF----NHYLSAMASMRQSQAVPADMR--------P
A0A3Q2GRS5_BCL2L11      TQTPSPPC-----QAF----NHYLSAMASMRQSQAVPADMR--------P
A0A3Q2LHE3_BIK-02       SSCPVGHSLAGCHSPH----QSLLSSFACFTHSSSCLFPGP-------LG
A0A3Q2HR24_BMF-01       QEGVLWKS-----AGL----QLPLSELLPFSPCCGTNGENL-------KQ
A0A3Q2HR24_BMF-02       VRGPVREL-----ETS----DLFLSCHPELPPAPGFCQDFV-------LS
A0A3Q2GWE8_BBC3-02      QRHRPSPW-----RVL----YNLIMGLLPLPRGRAAPEMEP--------N
A0A3Q2LHE3_BIK-01       PWSSCPVG-----HSL----AGCHSPHQSLLSSFACFTHSS--------S
A0A3Q2GRS5_BCL2L11      TQTPSPPC-----QAF----NHYLSAMASMRQSQAVPADMR--------P
F7DN67_BAD-01           TQMRQSPS--------------WTRAIQS---------------------
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GWE8_BBC3-01      QLGACTRPGDVGDLGGRTLPPPDALASAGGSFCTM---------------
A0A3Q2GRS5_BCL2L11      EVWIAQELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLV
A0A3Q2GRS5_BCL2L11      EVWIAQELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLV
A0A3Q2LHE3_BIK-02       LRWLAY--------------------------------------------
A0A3Q2HR24_BMF-01       PVWLL---------------------------------------------
A0A3Q2HR24_BMF-02       --WS----------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A3Q2LHE3_BIK-01       CLF-----------PGPLGLRWLAY-------------------------
A0A3Q2GRS5_BCL2L11      EVWIAQELRRIGDEFNASYPRRLEQ-------------------------
F7DN67_BAD-01           --WWDRNLGRGGSAPSQ---------------------------------
                                                                          

A0A3Q2I0H2_PMAIP1-      ----
A0A3Q2IBL3_HRK-01       ----
A0A3Q2GRS5_BCL2L11      ----
A0A3Q2GRS5_BCL2L11      ----
A0A3Q2GWE8_BBC3-01      ----
A0A3Q2GRS5_BCL2L11      RRLQ
A0A3Q2GRS5_BCL2L11      RRLQ
A0A3Q2LHE3_BIK-02       ----
A0A3Q2HR24_BMF-01       ----
A0A3Q2HR24_BMF-02       ----
A0A3Q2GWE8_BBC3-02      ----
A0A3Q2LHE3_BIK-01       ----
A0A3Q2GRS5_BCL2L11      ----
F7DN67_BAD-01           ----
                            

© 1998-2020Legal notice