Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      VRVSAGAARACLCQAPGASFSPWVPQQTRGPRERHGPSTPGGQLPGAGRG
A0A3Q2GRS5_BCL2L11      ---MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSAS
A0A3Q2GRS5_BCL2L11      ---MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSAS
A0A3Q2LHE3_BIK-02       ---------MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSV-------
A0A3Q2HR24_BMF-02       ---------MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLD
A0A3Q2HR24_BMF-01       ---------MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLD
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      PGPRRPAPLPAQPPGALGRV-----LRPLRARPARRA-RRARPAARCLPL
A0A3Q2GRS5_BCL2L11      PGLCLPRCLSGDNQGAPGRRKARAGRRGARARTRRSE-GKGRIKKDQMAK
A0A3Q2GRS5_BCL2L11      PGLCLPRCLSGDNQGAPGRRKARAGRRGARARTRRSE-GKGRIKKDQMAK
A0A3Q2LHE3_BIK-02       --------------------PKAVWSSVGEEMSQVGPVSRDLFLDAFLHE
A0A3Q2HR24_BMF-02       CPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASP-SQGVMLPCGVTE
A0A3Q2HR24_BMF-01       CPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASP-SQGVMLPCGVTE
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A3Q2IBL3_HRK-01       -------------------------------------------MCPCPLH
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------MSQVGP
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------MFQIPE
                                                                          

A0A3Q2I0H2_PMAIP1-      ------------MPTRKARKSGQPSPTRAPAELEAE-------CAIQIRR
A0A5F5PGZ4_BBC3-01      RPR---------RPARRHRRPGGPPLAWGPPQPSPS-PAPRRSTA-----
A0A3Q2GRS5_BCL2L11      QPS---------DVSSECDREGGQ---LQPAERPPQ-LRPGAPTS-----
A0A3Q2GRS5_BCL2L11      QPS---------DVSSECDREGGQ---LQPAERPPQ-LRPGAPTS-----
A0A3Q2LHE3_BIK-02       ------------RSPEALEVPGMTELTESSPDSDNR-D----SVAMRLAF
A0A3Q2HR24_BMF-02       EPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQ-HRAEVQIARKLQC
A0A3Q2HR24_BMF-01       EPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQ-HRAEVQIARKLQC
A0A5F5PGZ4_BBC3-02      -VRV------SAGAARACLCQAPG---ASFSPWVPQQTRGPQPSLLPAEQ
A0A3Q2IBL3_HRK-01       RGRG------PPAV---CACSAGR---LGLRSSAAQ-LTAARLKALGDEL
A0A3Q2GRS5_BCL2L11      MAKQ------PSDVSSECDREGGQ---LQPAERPPQ-LRPGAPTSLQIEQ
A0A3Q2GRS5_BCL2L11      MAKQ------PSDVSSECDREGGQ---LQPAERPPQ-LRPGAPTSLQIEQ
A0A3Q2LHE3_BIK-01       VSRDLFLDAFLHERSPEALEVPGM---TELTESSPD-SDNRDSVAMRLAF
A0A3Q2GRS5_BCL2L11      MAKQ------PSDVSSECDREGGQ---LQPAERPPQ-LRPGAPTSLQIEQ
F7DN67_BAD-01           FEQS------EPEDSSPADRGLGP---SPTGDWPSDPVRHQRTAPGLLGE
                                                                          

A0A3Q2I0H2_PMAIP1-      IGDKLNFR------------------------------------------
A0A5F5PGZ4_BBC3-01      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-02       IGDEMEVRWMLPHIAELPGVAVYSLAFTYNQTG--------LRGVFRSFM
A0A3Q2HR24_BMF-02       IADQFHRLHMQQHQQNRNRVWWQTLLFLHN--------------------
A0A3Q2HR24_BMF-01       IADQFHRLHMQQHQQNRNRVWWQTLLFLHN--------------------
A0A5F5PGZ4_BBC3-02      H-------------------------------------------------
A0A3Q2IBL3_HRK-01       H-------------------------------------------------
A0A3Q2GRS5_BCL2L11      Q-------------------------------------------------
A0A3Q2GRS5_BCL2L11      Q-------------------------------------------------
A0A3Q2LHE3_BIK-01       IGDEMEVRWMLPHIAELPGVAVYSLAFTYNQTG--------LRGVFRSFM
A0A3Q2GRS5_BCL2L11      QGNPGGEGDRCPQGSPLGPLAPPA-----------------SPGPFATRS
F7DN67_BAD-01           AGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEDEGMEGEEPGPFRGRS
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      -----------------------LTLAGRAAPGVAGAQRPGGPGGRPHPG
A0A3Q2GRS5_BCL2L11      -----------------------LQIEQQ---------------------
A0A3Q2GRS5_BCL2L11      -----------------------LQIEQQGNPGGEGDRCPQGSPLGPL-A
A0A3Q2LHE3_BIK-02       DGLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCSPL-----------
A0A3Q2HR24_BMF-02       -----------------------LALNGDENRNGAGPRC-----------
A0A3Q2HR24_BMF-01       -----------------------LALNGDENRNGAGPSF-----------
A0A5F5PGZ4_BBC3-02      ----------------------------LESPVPSAP-------------
A0A3Q2IBL3_HRK-01       ----------------------------QRTMWRRRA-------------
A0A3Q2GRS5_BCL2L11      ----------------------------DRSPAPMSC-------------
A0A3Q2GRS5_BCL2L11      ----------------------------ASMRQSQAV-------------
A0A3Q2LHE3_BIK-01       DGLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCS-------------
A0A3Q2GRS5_BCL2L11      ----PFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSC-------------
F7DN67_BAD-01           RSAPPNLWAARRYGRELRRMSDEFQVSFQALPRPKSA-------------
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      SPGSPGGGGAVGPG----------------------DRGPAAADGGRPER
A0A3Q2GRS5_BCL2L11      ------------------------------------DRSPAPMSC---DK
A0A3Q2GRS5_BCL2L11      PPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSC---DK
A0A3Q2LHE3_BIK-02       ------------------------------------------------EP
A0A3Q2HR24_BMF-02       ------------------------------------------------GK
A0A3Q2HR24_BMF-01       ------------------------------------------------QP
A0A5F5PGZ4_BBC3-02      ------------------------------------------------GA
A0A3Q2IBL3_HRK-01       ------------------------------------------------RS
A0A3Q2GRS5_BCL2L11      ------------------------------------------------DK
A0A3Q2GRS5_BCL2L11      ------------------------------------------------PA
A0A3Q2LHE3_BIK-01       ------------------------------------------------PL
A0A3Q2GRS5_BCL2L11      ------------------------------------------------DK
F7DN67_BAD-01           ------------------------------------------------GT
                                                                          

A0A3Q2I0H2_PMAIP1-      ---------------------QKLLNLIAKLFRSGT--------------
A0A5F5PGZ4_BBC3-01      AVRAAETRG-----AAA----TPPLALEGPVQSHHGTPAPTQGPSGPGDG
A0A3Q2GRS5_BCL2L11      STQTPSPPC-----QAF----NHYLSAMASMRQSQAVPADMR--------
A0A3Q2GRS5_BCL2L11      STQTPSPPC-----QAF----NHYLSAMASMRQSQAVPADMR--------
A0A3Q2LHE3_BIK-02       WSSCPVGHSLAGCHSPH----QSLLSSFACFTHSSSCLFPGP-------L
A0A3Q2HR24_BMF-02       NVRGPVREL-----ETS----DLFLSCHPELPPAPGFCQDFV-------L
A0A3Q2HR24_BMF-01       GQEGVLWKS-----AGL----QLPLSELLPFSPCCGTNGENL-------K
A0A5F5PGZ4_BBC3-02      LEGGPTQAA-----PGVRGEEEQWAREIGAQLRRMADDLNAL--------
A0A3Q2IBL3_HRK-01       RRAPAPGAL-----PTY----WPWLCAAAQVAALAAWLLGRR--------
A0A3Q2GRS5_BCL2L11      STQTPSPPC-----QAF----NHYLSAMVRAIEEVVV-------------
A0A3Q2GRS5_BCL2L11      DMRPEVWIA-----QELRRIGDEFNASYPRRLAQCLAFYT----------
A0A3Q2LHE3_BIK-01       EPWSSCPVG-----HSL----AGCHSPHQSLLSSFACFTHSS--------
A0A3Q2GRS5_BCL2L11      STQTPSPPC-----QAF----NHYLSAMASMRQSQAVPADMR--------
F7DN67_BAD-01           ATQMRQSPS--------------WTRAIQS--------------------
                                                                          

A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      AQLGACTRPGDVGDLGGRTLPPPDALASAGGSFCTM--------------
A0A3Q2GRS5_BCL2L11      PEVWIAQELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRL
A0A3Q2GRS5_BCL2L11      PEVWIAQELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRL
A0A3Q2LHE3_BIK-02       GLRWLAY-------------------------------------------
A0A3Q2HR24_BMF-02       S--WS---------------------------------------------
A0A3Q2HR24_BMF-01       QPVWLL--------------------------------------------
A0A5F5PGZ4_BBC3-02      YERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN--------
A0A3Q2IBL3_HRK-01       NL------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-01       SCLF-----------PGPLGLRWLAY------------------------
A0A3Q2GRS5_BCL2L11      PEVWIAQELRRIGDEFNASYPRRLEQ------------------------
F7DN67_BAD-01           ---WWDRNLGRGGSAPSQ--------------------------------
                                                                          

A0A3Q2I0H2_PMAIP1-      -----
A0A5F5PGZ4_BBC3-01      -----
A0A3Q2GRS5_BCL2L11      VRRLQ
A0A3Q2GRS5_BCL2L11      VRRLQ
A0A3Q2LHE3_BIK-02       -----
A0A3Q2HR24_BMF-02       -----
A0A3Q2HR24_BMF-01       -----
A0A5F5PGZ4_BBC3-02      -----
A0A3Q2IBL3_HRK-01       -----
A0A3Q2GRS5_BCL2L11      -----
A0A3Q2GRS5_BCL2L11      -----
A0A3Q2LHE3_BIK-01       -----
A0A3Q2GRS5_BCL2L11      -----
F7DN67_BAD-01           -----
                             

© 1998-2022Legal notice