Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQASMRQSQAVPADMRPEVWIAQELRRIGDEFNASYPRRLA
QCLAFYT
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEVVV
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=289 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGLCLPRCLSGDNQGAPGRRKARAGRRGARART
RRSEGKGRIKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPG
PFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIA
QELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=233 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGLCLPRCLSGDNQGAPGRRKARAGRRGARART
RRSEGKGRIKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQDRSPAPMSCDKSTQTPSPPCQAFNHY
LSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNAS
YPRRLEQ
>gnl|bcl2dbpro|A0A3Q2GWE8_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=131 residues).
VRVSAGAARACLCQAPGASFSPWVPQQTRGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN
>gnl|bcl2dbpro|A0A3Q2GWE8_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=261 residues).
VRVSAGAARACLCQAPGASFSPWVPQQTRGPRERHGPSTPGGQLPGAGRGPGPRRPAPLPAQPPGALGRVLRPLRARPAR
RARRARPAARCLPLRPRRPARRHRRPGGPPLAWGPPQPSPSPAPRRSTALTLAGRAAPGVAGAQRPGGPGGRPHPGSPGS
PGGGGAVGPGDRGPAAADGGRPERAVRAAETRGAAATPPLALEGPVQSHHGTPAPTQGPSGPGDGAQLGACTRPGDVGDL
GGRTLPPPDALASAGGSFCTM
>gnl|bcl2dbpro|A0A3Q2HR24_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=224 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLSWS
>gnl|bcl2dbpro|A0A3Q2HR24_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=227 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL
>gnl|bcl2dbpro|A0A3Q2I0H2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Equus caballus GN=PMAIP1 (length=54 residues).
MPTRKARKSGQPSPTRAPAELEAECAIQIRRIGDKLNFRQKLLNLIAKLFRSGT
>gnl|bcl2dbpro|A0A3Q2IBL3_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Equus caballus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A3Q2LHE3_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=226 residues).
MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSVPKAVWSSVGEEMSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTE
SSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFTYNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDR
VSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|A0A3Q2LHE3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=181 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFT
YNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFA
CFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|F7DN67_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus caballus GN=BAD (length=167 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSFQALPRPKSAGTATQMRQSPSWTRAIQSWWDRNLGR
GGSAPSQ
© 1998-2020Legal notice