Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

21 sequence(s)

>gnl|bcl2dbpro|A0A3Q2HR24_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=227 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL
>gnl|bcl2dbpro|A0A3Q2HR24_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=281 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPSPLGRSPLPQENLMKREVERVESTRSRKTSAAAAQLARQGVCESVLQPRLEEAAESL
CVLARTLGGRPRRPHSFQEGVNLSACVGSWGHCGQQAPRGW
>gnl|bcl2dbpro|A0A3Q2HR24_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=224 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLSWS
>gnl|bcl2dbpro|A0A3Q2HR24_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=201 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPRKDPRKGLFEGVYPSMPQ
>gnl|bcl2dbpro|A0A3Q2HR24_BMF-06 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=220 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPSWCLGREIHPHAESAVWPSEKRISFGIEPGFKCFFCH
>gnl|bcl2dbpro|A0A3Q2HR24_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=199 residues).
MGGCGERFEVLETRDMEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQ
EDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFH
RLHMQQHQQNRNRVWWQTLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A3Q2LHE3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=181 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFT
YNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFA
CFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|A0A5F5PGZ4_BBC3-05 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=131 residues).
VRVSAGAARACLCQAPGASFSPWVPQQTRGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN
>gnl|bcl2dbpro|A0A5F5PGZ4_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=250 residues).
MSVPGAWGFLLTLGPPADSWQVWPGVHAPECVPSVGQLAGTCHRSDFVTVSRAPGSAMARARQEGSSPEPVEGLARDGPR
PFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPAAPPAVTAALGGPRWPGGPRSRPRAPRPDGPQPSLLPAEQH
LESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPR
GRAAPEMEPN
>gnl|bcl2dbpro|A0A5F5PGZ4_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=209 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPAAPPAVTAALGGPRWPGG
PRSRPRAPRPDGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALDKRSSSDTA
PRPGGSCTISSWDSCPYPGAERPRRWSPTRCLHPPGGRRGLGGQDPPTS
>gnl|bcl2dbpro|A0A5F5PGZ4_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=402 residues).
APCLPRSPPSTPPRAPWAGVAGREAPRVRERRCLRGPAGLFTNNGVRARQRPLAVPCGPGEVRRPRRPRPPQSGRGARGG
GDGVAGRPHPGRAPAGGGDRGRLAGRGVCGSGGRGLRPSNSRLLAPRSPGGRGGRTWRRRGGGAVTARGASGPAVGARVC
GAVDLQVSRLGPRERHGPSTPGGQLPGAGRGPGPRRPAPLPAQPPGALGRVLRPLRARPARRARRARPAARCLPLRPRRP
ARRHRRPGGPPLAWGPPQPSPSPAPRRSTALTLAGRAAPGVAGAQRPGGPGGRPHPGSPGSPGGGGAVGPGDRGPAAADG
GRPERAVRAAETRGAAATPPLALEGPVQSHHGTPAPTQGPSGPGDGAQLGACTRPGDVGDLGGRTLPPPDALASAGGSFC
TM
>gnl|bcl2dbpro|A0A5F5PGZ4_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=353 residues).
MHCGYSSSDGLCVFVCAQFWSVCVCVCVSCVLSSNIRDGDHLDVSVQRGDEVGGQAGQSRVSPCVFVLCTLIHTPTVFSM
WVLCESLCVLWEHPSAWLPSVCAHHCVLEVNPTAHALCESQGPRERHGPSTPGGQLPGAGRGPGPRRPAPLPAQPPGALG
RVLRPLRARPARRARRARPAARCLPLRPRRPARRHRRPGGPPLAWGPPQPSPSPAPRRSTALTLAGRAAPGVAGAQRPGG
PGGRPHPGSPGSPGGGGAVGPGDRGPAAADGGRPERAVRAAETRGAAATPPLALEGPVQSHHGTPAPTQGPSGPGDGAQL
GACTRPGDVGDLGGRTLPPPDALASAGGSFCTM
>gnl|bcl2dbpro|A0A5F5PK35_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQASMRQSQAVPADMRPEVWIAQELRRIGDEFNASYPRRLA
QCLAFYT
>gnl|bcl2dbpro|A0A5F5PK35_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNAS
YPRRGTMPAFTPLRYAGDLRAREPLTQPPLLSLDPP
>gnl|bcl2dbpro|A0A5F5PK35_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNAS
YPRRLEQ
>gnl|bcl2dbpro|A0A5F5PK35_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNAS
YPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQR
>gnl|bcl2dbpro|A0A5F5PK35_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=209 residues).
MRSNQLVLKKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPG
PFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIA
QELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
>gnl|bcl2dbpro|F7DN67_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus caballus GN=BAD (length=232 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGRHPQTQPLACPPCPQVR
SSPHPGHLHTHWVTLSTSSPEERGHSDADAAKPQLDARHPVLVGSELGERRLRPLPVTFHPHPETPAPAAAGGHPGCGRK
SLPQALSKERIHSVSFGRRRSDPRPTPFRACEDHGGCDPVGSFSALTRRKWPRDPAPAPGCPRRLRQVASRG
>gnl|bcl2dbpro|F7DN67_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus caballus GN=BAD (length=205 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSFQVSAGAAHTPGPVLPGHLPLGCPIRVPVHVGTDVS
GPFPSHGPVPKSQGMLGSVVPGPLPSHRPVPESQGMPGSVVQTAP
>gnl|bcl2dbpro|F7DN67_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus caballus GN=BAD (length=167 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSFQALPRPKSAGTATQMRQSPSWTRAIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|F7DN67_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus caballus GN=BAD (length=179 residues).
MLLFLILKPTQSMFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVE
TRSRHSSYPEGTEDEGMEGEEPGPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSFQALPRPKSAGTATQMRQSPSWTR
AIQSWWDRNLGRGGSAPSQ
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice